KEGG   Desulfosporosinus acidiphilus: Desaci_2289Help
Entry
Desaci_2289       CDS       T02148                                 

Definition
(GenBank) ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00051  Fructose and mannose metabolism
dai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Desaci_2289
Enzymes [BR:dai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Desaci_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFM41244
UniProt: I4D620
Position
2363052..2363702
Genome map
AA seq 216 aa AA seqDB search
MDQIIFARQNVVDIGKEILSTKLTVGTWGNISCRVPNHECFVITPTGMNYDILTHDDIVV
MDYKGDRLAGSRLPSIELPLHLAIYHARPDVQAIIHTHSAYATAVAAARKEIPGAVEDLV
QIVGGNVRVNEYAPPGSKQLGLNTVKALEGRNAVLLANHGMLGVGSNLDEALKVCQIVEK
AAKITIFAQLLGGVVELSSEDIEGMRNFYLHSYGQR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatcagataatatttgctcggcaaaatgtagttgatataggtaaggaaatattgtca
acaaagcttacagtggggacttggggaaatataagctgccgggtacctaatcatgaatgt
tttgttatcactccaacagggatgaactatgacatcttaactcatgatgacattgtagtt
atggactataaaggggatagattagctggttcaagattaccctcgattgaattgccgctt
catttggctatttatcatgcacggccggacgttcaggcaattattcatacgcatagcgct
tacgcgactgccgtggctgctgctcgaaaagaaattccgggagctgtagaagatttggtt
caaattgtcggtggtaatgttcgggttaacgaatacgctccgcctggaagtaagcaatta
ggtctgaatacggtaaaggctttggagggcagaaatgccgttttgcttgccaatcatggt
atgcttggggttggcagtaatttagacgaagctttgaaggtttgccaaattgttgagaaa
gcagcaaaaataacgattttcgctcagttgttgggcggagttgtggaattatcctcagaa
gatattgagggaatgaggaacttttatcttcatagttacggacaaagataa

DBGET integrated database retrieval system