KEGG   Desulfosporosinus acidiphilus: Desaci_2493Help
Entry
Desaci_2493       CDS       T02148                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desaci_2493
Enzymes [BR:dai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Desaci_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2598205..2599254
Genome map
AA seq 349 aa AA seqDB search
MKQLNIGLLIKAIITLSVILILLGAFLFYGWQTYIQRQARSAYESWLSYIVPAGTNRDRV
INPQMENSTVSEGIGYGMLFSVAFDDIYHFDRLWSYANHNLDAKGLMNWKIGKNGEILGQ
GSATDADQDIAYALILAEEKWPGRGYVQAAKQILNSIVTYESDQEGLLLPGDNWGNPEIY
NPSYIAPAYYELFYKITGNLVWEKIAQANSNWLVKTLNNTTGLAPDWADHLGYPKDNNYG
YDAIRVPIRWICYYRQNHNVNARNILGKELGTLKLLAKRGLKSGYTLEGVPTVNFLNTDY
LASFTALSLYKPYSPLSISLIWRLSHSQSPTYYGNAMKVWVMSLAANKF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaattaaatatcggtttattaataaaggcaattattacattatctgtaatcctt
attttactgggtgcttttcttttttacggttggcaaacttatattcagcgacaggcacgc
agtgcttatgaaagttggcttagttacattgtaccagcgggtactaatagggacagagtt
ataaatcctcaaatggaaaatagcactgttagtgaaggtataggatatggcatgcttttt
tctgtggcgttcgatgatatttaccactttgatcgtctttggtcctacgcgaatcataat
ctagatgcaaagggtttgatgaattggaaaattgggaagaatggtgagatccttgggcaa
ggatcagcaacggatgccgatcaagatattgcttatgccttaattttagctgaggagaaa
tggccgggacgcggttatgttcaagcggcaaaacaaatactcaattctattgtcacctat
gaatcagatcaagaaggattattgttgcctggagacaattggggtaatccggaaatttat
aacccatcctatattgctccggcatattatgaactattttataaaataaccggaaattta
gtctgggagaaaatagctcaagccaattcaaattggctagtaaagacccttaataataca
acaggactcgctcccgactgggctgatcacttagggtatcctaaagataacaattatggt
tatgatgcaattagagtgcctattcgatggatttgttattatcgacagaatcataatgtt
aatgcccgtaatattttgggaaaggaactaggtaccctgaaacttttggcaaaacgcgga
ctcaagtctggatatactctcgagggcgtcccgactgtcaattttctcaatactgattat
ctggcatcatttacagcgctgagcctttataaaccgtactccccattatcaatttctcta
atctggagacttagtcatagccaaagtccaacttattatggtaatgcaatgaaggtttgg
gtgatgagtctagccgctaataaattttaa

DBGET integrated database retrieval system