KEGG   Desulfosporosinus acidiphilus: Desaci_2493Help
Entry
Desaci_2493       CDS       T02148                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dai00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2598205..2599254
Genome map
AA seq 349 aa AA seqDB search
MKQLNIGLLIKAIITLSVILILLGAFLFYGWQTYIQRQARSAYESWLSYIVPAGTNRDRV
INPQMENSTVSEGIGYGMLFSVAFDDIYHFDRLWSYANHNLDAKGLMNWKIGKNGEILGQ
GSATDADQDIAYALILAEEKWPGRGYVQAAKQILNSIVTYESDQEGLLLPGDNWGNPEIY
NPSYIAPAYYELFYKITGNLVWEKIAQANSNWLVKTLNNTTGLAPDWADHLGYPKDNNYG
YDAIRVPIRWICYYRQNHNVNARNILGKELGTLKLLAKRGLKSGYTLEGVPTVNFLNTDY
LASFTALSLYKPYSPLSISLIWRLSHSQSPTYYGNAMKVWVMSLAANKF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaattaaatatcggtttattaataaaggcaattattacattatctgtaatcctt
attttactgggtgcttttcttttttacggttggcaaacttatattcagcgacaggcacgc
agtgcttatgaaagttggcttagttacattgtaccagcgggtactaatagggacagagtt
ataaatcctcaaatggaaaatagcactgttagtgaaggtataggatatggcatgcttttt
tctgtggcgttcgatgatatttaccactttgatcgtctttggtcctacgcgaatcataat
ctagatgcaaagggtttgatgaattggaaaattgggaagaatggtgagatccttgggcaa
ggatcagcaacggatgccgatcaagatattgcttatgccttaattttagctgaggagaaa
tggccgggacgcggttatgttcaagcggcaaaacaaatactcaattctattgtcacctat
gaatcagatcaagaaggattattgttgcctggagacaattggggtaatccggaaatttat
aacccatcctatattgctccggcatattatgaactattttataaaataaccggaaattta
gtctgggagaaaatagctcaagccaattcaaattggctagtaaagacccttaataataca
acaggactcgctcccgactgggctgatcacttagggtatcctaaagataacaattatggt
tatgatgcaattagagtgcctattcgatggatttgttattatcgacagaatcataatgtt
aatgcccgtaatattttgggaaaggaactaggtaccctgaaacttttggcaaaacgcgga
ctcaagtctggatatactctcgagggcgtcccgactgtcaattttctcaatactgattat
ctggcatcatttacagcgctgagcctttataaaccgtactccccattatcaatttctcta
atctggagacttagtcatagccaaagtccaacttattatggtaatgcaatgaaggtttgg
gtgatgagtctagccgctaataaattttaa

DBGET integrated database retrieval system