KEGG   Desulfosporosinus acidiphilus: Desaci_2770Help
Entry
Desaci_2770       CDS       T02148                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desaci_2770
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Desaci_2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2902674..2903612)
Genome map
AA seq 312 aa AA seqDB search
MRSIAVIGSLNMDIVNRVEKAPLPGQTIKALETSYVPGGKGANQAVAAARAGARVEMFGA
VGADTYGEILLENLRSSRVGTESVLLKQDVGTGLAFITVDELGENSIIISPGANGKVETQ
DVQVEERQLLEPDIIILQNEIPYSTVAYALEYFGAKGKYIIYNPAPAFAPPENAFSRVGL
LILNETEAAVLSGAETGTIEEVHSAAKILVDKGCREVIVTLGAKGLFYLNREGTTVYLPA
FKVAVTDTTAAGDTFVGAYATAMVEGKPVQEALRFASAASALTVTRKGAQTSIPERLEID
AFLSQRQFVDDL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctattgcggtcataggcagcctcaatatggacatagtcaacagggttgagaaa
gcacctttaccgggtcagactattaaagctcttgagacaagctatgttcccggcggaaaa
ggagcaaatcaagctgttgctgccgctcgtgcaggagcaagagtcgaaatgtttggcgcc
gtgggtgcggacacttacggagaaattctgctggagaacctgagatcttcccgtgtcgga
acggaaagtgttcttcttaaacaagatgtaggaacaggattggccttcattaccgtagat
gaacttggagaaaacagtatcataatttctccgggcgctaatggaaaagtggaaacccag
gatgtccaggttgaggaaaggcaattgctggagcctgatatcatcattttacagaatgag
ataccttactctacagttgcttatgccttggaatattttggggcgaaagggaaatatatt
atctacaatcctgctccagcattcgcaccgccggagaacgcttttagccgggttggtctg
ctgattctcaatgaaacggaagcagctgtcttatccggggcagaaacgggaactatagaa
gaagttcattccgctgccaagattttggtggacaaaggatgccgggaagtcattgtaact
ttgggagccaaaggattattttacttgaacagggaaggaacaacggtctatttgccggcg
tttaaagttgcggtgaccgataccactgcggcgggtgatacctttgttggtgcgtacgca
actgctatggttgaaggtaagccagttcaagaagcgctgcgttttgcttcagcagcctcg
gctctaaccgttaccagaaaaggtgcccagacatcaattcctgaacggttagaaattgat
gcttttttaagccaaaggcagttcgttgatgacttataa

DBGET integrated database retrieval system