KEGG   Desulfosporosinus acidiphilus: Desaci_2855Help
Entry
Desaci_2855       CDS       T02148                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desaci_2855
   00052 Galactose metabolism
    Desaci_2855
   00500 Starch and sucrose metabolism
    Desaci_2855
   00520 Amino sugar and nucleotide sugar metabolism
    Desaci_2855
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desaci_2855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2989526..2990440)
Genome map
AA seq 304 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVQSGIESILIVTGRNK
KSIEDHFDKSVELEQTLKDKGKTEVLSELQRINELANIHYIRQKEPLGLGHAVLCAEQFI
GNEPFAVLLGDDIMVSQTPGLQQLIEVYESYNTTVVGVQPVPTDDVCKYGIIAPTAYKTQ
TYQVKDLIEKPSGFQAPSNLAIMGRYILKPSIFPVLHSLDRGAGNEYQLTDALRQVCKNE
GLLAWELLGERYDIGDKFGYIKAIVEMGLQREELEPQLMAYLLHIINRKQSLTETKIRAL
CSSF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaagaaggccattatcccggccgccggtttagggacaagatttttaccggca
acaaaggctcagcctaaagagatgctgccgattgtcgataaaccggccattcaatatatc
gttgaagaagctgttcaatccggtattgaaagcattctcattgtaaccggtcgtaataaa
aagtccattgaagaccattttgacaagtcagtagaactggaacaaaccttgaaagataag
gggaagacagaggtcctcagtgagctgcaacggattaacgaactggctaatatccattat
attcgtcagaaagaaccgttaggattagggcatgccgtcctctgcgccgagcaatttatt
ggcaatgagccctttgcagttttgttgggggatgatatcatggtttcccagacaccaggc
ctgcaacaattgatagaggtttatgagagttacaatactacggtagtgggtgtacagccg
gtaccaacggatgacgtttgcaaatatggaattatcgccccaacagcctataaaactcaa
acgtatcaggttaaagacctcattgaaaagccgtcaggttttcaggccccttctaatctg
gcaattatgggcaggtatattttaaaaccgtcaatcttcccggttcttcactcgttggac
agaggagcgggaaatgaatatcaactaactgatgccttgcgccaggtttgcaaaaacgaa
ggtctcttagcttgggagttgttgggggagcgatatgacattggtgataagtttggatat
ataaaagcaattgtggaaatgggactgcagagggaagaattagaaccacagcttatggca
tatttgctgcacattataaacagaaagcagagcctaacggagacaaagataagagcattg
tgttcgagtttttaa

DBGET integrated database retrieval system