KEGG   Desulfosporosinus acidiphilus: Desaci_3067Help
Entry
Desaci_3067       CDS       T02148                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desaci_3067
Enzymes [BR:dai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Desaci_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3213693..3214265)
Genome map
AA seq 190 aa AA seqDB search
MGMDLEKIEKAVYMILEAIGEDPEREGLLDTPKRVARMYAEVFAGLHEDPSRHLKVQFSE
EHEEMVIVKDIPVYSMCEHHLVPFYGKAHVAYIPRKGKITGLSKFARVVEGYARRPQLQE
RLTSQIADAIMGELTPLGVLVVIEAEHMCMTMRGVKKAGSQTLTSAVRGIFKSNSITRSE
AFSLIQGNRS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggggatggatttagaaaagattgaaaaggctgtatatatgattttagaagctattggg
gaggatcctgagagagaagggcttcttgatacacctaaacgtgttgccaggatgtatgcc
gaagtatttgctgggctgcatgaagaccccagcaggcatttaaaagttcagttttcagag
gaacatgaggaaatggtgattgtcaaagatattccagtctattcgatgtgtgagcaccat
ctggtacctttttatggaaaggcccatgttgcctatattcccagaaagggaaagattacc
ggtttatcgaaattcgcccgtgtcgttgaaggatatgcacgcagacctcaacttcaggaa
cgactgacttcgcagatagctgatgccattatgggtgaacttacaccgttaggagttctg
gtggtaattgaggcagagcatatgtgtatgaccatgcgcggtgtaaagaaagcgggttca
caaacattgacgtctgcagtccgtggaatttttaaatcgaattcgataaccagatcagaa
gctttttccttaattcaaggtaatagaagttaa

DBGET integrated database retrieval system