KEGG   Desulfosporosinus acidiphilus: Desaci_3087Help
Entry
Desaci_3087       CDS       T02148                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desaci_3087
   01230 Biosynthesis of amino acids
    Desaci_3087
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_3087
   00030 Pentose phosphate pathway
    Desaci_3087
   00051 Fructose and mannose metabolism
    Desaci_3087
   00052 Galactose metabolism
    Desaci_3087
  Energy metabolism
   00680 Methane metabolism
    Desaci_3087
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desaci_3087
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desaci_3087
Protein phosphatases and associated proteins [BR:dai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desaci_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3232980..3233951)
Genome map
AA seq 323 aa AA seqDB search
MAGEIQRIGVLTSGGDAPGMNAAVRAVVRKGIFHGLTIFGIHRGYEGLIHGELQEMSIGS
VADIVLRGGTVLKTARSEEMKTPAGQKKAFEQLQKRQIDALVVIGGDGSFRGAQTLAAQG
VRIIGIPGTIDNDIAGTDLTIGFDTAVNTVVDAVSKIRDTASSHDRTFIVEVMGRNCGNI
ALQAGLACGAESILVPEIPYDLDEISNKLKRGHQRGKNHSIILVSEGVGSAFKVGEELRA
RSGFETRITVLGHLQRGGNPSALDAVIAAAMGGKAVQSLLDQETNRMTAYINQTVISRPL
DDAYGTRRPLNRELYDLANELSI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggagattcagaggatcggggtacttacaagcggaggagatgccccaggcatg
aatgcagctgtacgggcagttgttcgtaaagggatttttcatggcttaacaattttcggt
attcatcgaggttatgaaggactcattcatggagaactacaagaaatgagtataggttct
gttgctgatatcgtactaaggggaggaactgtcctaaaaactgcccgctcggaagaaatg
aaaactccggcgggacagaaaaaggcttttgagcaactccaaaaacgccagatcgatgct
ctagttgttataggcggagatggttcctttagaggtgcacagactctagctgctcaagga
gttcggattatcggaattccgggtaccatcgataatgatattgccggaacggatttaacg
attgggtttgataccgcagttaataccgtggttgatgccgtaagtaaaattcgcgatacg
gcttcttcccacgatcggacatttatcgtagaggttatgggcagaaattgcgggaatatt
gctttacaggcagggttggcttgtggtgcagagtccattttagtgcctgagatcccttat
gatttagatgaaatcagcaataaattaaaaaggggtcaccagcgggggaaaaatcatagt
attatccttgtttcagaaggggttggcagtgctttcaaagttggtgaagaattgcgggcc
cgctcagggtttgagacccggatcacagttcttggtcacttgcagcgcggaggaaatccc
agtgcacttgacgccgtgattgctgcggccatgggaggaaaggcagtccagagcctttta
gatcaagagacaaatcgtatgacagcctatattaatcaaacggtaatttcccgtcctctc
gacgatgcttatggcacacggcgccccttaaatcgcgaactttatgatttagccaatgag
ttgtcaatttaa

DBGET integrated database retrieval system