KEGG   Desulfosporosinus acidiphilus: Desaci_3488Help
Entry
Desaci_3488       CDS       T02148                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desaci_3488
Enzymes [BR:dai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Desaci_3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3633810..3634412)
Genome map
AA seq 200 aa AA seqDB search
MIGMLRGTVWEIQAERLVLDVQGTGYLLTVPSGLLAKVFPGQKLVLYTHVVMREDDLSLY
GFMSLGEKQLFLEMLGVSGIGPKAAISLLSTFGAAQIESAIVSENLNLLTKVPGIGKKIA
QRLILELKEKFKGLSLVSNNQETTMADLNPTQHSDALQTLLALGFGLEEARRALGHAGKD
GGDLPTEEQVKKALRKLAGG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgataggaatgttgcgcgggacagtttgggaaatccaagcggaacgtttagtgctggat
gtccagggaactggctatttgctgacggtaccaagcggtcttttagccaaggtttttccg
ggtcagaaacttgttctttatactcatgtggtgatgcgtgaggatgatttatctctttat
ggattcatgtccctgggggaaaaacaactatttttagagatgctgggtgtttcgggcatt
ggtcccaaggccgccatatcgttattgtccacctttggagcagcacagatagaaagtgct
atcgttagtgaaaatcttaatctcttaacaaaggttccagggataggaaagaaaattgcc
caacgcttaattttagaacttaaagagaagtttaaaggactctccttagtttcaaataat
caggaaacaaccatggctgatttgaatccgacccagcattccgatgcccttcaaaccttg
ctggctcttggcttcggcctggaggaagccagacgggccctgggtcacgccggaaaagac
ggaggagatttacccacggaggagcaagtgaaaaaagccttgcgcaagctggcgggaggt
tga

DBGET integrated database retrieval system