KEGG   Desulfosporosinus acidiphilus: Desaci_3697Help
Entry
Desaci_3697       CDS       T02148                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desaci_3697
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desaci_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3853834..3854439)
Genome map
AA seq 201 aa AA seqDB search
MEKSHGLLIVLSGPSGAGKGTLCQELLRQMPNLKYSVSMTTRLPRPGEVDGVHYFFRSRE
DVEAMIARDELLEWAQFCDNYYGTPRFAVEQAIVDGQDVILEIEIQGALQVKKRFPQGVF
TFIVPPSLAALSERIHKRGTESEEVIQKRLATAIQELEYVSEYDYVVVNDEIPAAVDKLK
SIIIAEKCRVKRKPFVFKEES
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaagtcatgggttattaattgtcctttccggaccttcgggtgcagggaaagga
accctttgtcaggaattgcttcgccaaatgcctaatttaaaatattctgtctcgatgacc
acccgcttaccgcgtcccggtgaagtggatggagttcattactttttccgctcgcgggaa
gatgtcgaagcaatgatcgccagagacgaattgttggaatgggctcagttttgtgataac
tactatgggacaccaaggttcgcagtagagcaagctattgtggacggtcaggatgttatt
ttagagatagaaatccaaggtgccttacaagttaaaaagcgttttcctcagggagtcttt
accttcatagttcctccttccctcgctgcgctctcagagcggatacataaacggggaact
gagtctgaggaagttattcaaaagcgtttagctactgctatacaggaattggagtatgtc
agtgaatatgactacgttgtggtcaatgatgaaattcctgcggctgttgataaattgaag
agtattattatcgctgaaaaatgtcgggtcaaacgaaaaccgttcgtttttaaggaggaa
tcctaa

DBGET integrated database retrieval system