KEGG   Desulfosporosinus acidiphilus: Desaci_3697Help
Entry
Desaci_3697       CDS       T02148                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00230  Purine metabolism
dai01100  Metabolic pathways
Module
dai_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desaci_3697
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desaci_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RNA_helicase AAA_33 ADK AAA_17 TsaE RsgA_GTPase Cytidylate_kin cobW ABC_tran PduV-EutP Thymidylate_kin AAA_28 APS_kinase AAA AAA_5 ATP_bind_1 AAA_29 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AFM42578
UniProt: I4D9V4
Position
complement(3853834..3854439)
Genome map
AA seq 201 aa AA seqDB search
MEKSHGLLIVLSGPSGAGKGTLCQELLRQMPNLKYSVSMTTRLPRPGEVDGVHYFFRSRE
DVEAMIARDELLEWAQFCDNYYGTPRFAVEQAIVDGQDVILEIEIQGALQVKKRFPQGVF
TFIVPPSLAALSERIHKRGTESEEVIQKRLATAIQELEYVSEYDYVVVNDEIPAAVDKLK
SIIIAEKCRVKRKPFVFKEES
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaagtcatgggttattaattgtcctttccggaccttcgggtgcagggaaagga
accctttgtcaggaattgcttcgccaaatgcctaatttaaaatattctgtctcgatgacc
acccgcttaccgcgtcccggtgaagtggatggagttcattactttttccgctcgcgggaa
gatgtcgaagcaatgatcgccagagacgaattgttggaatgggctcagttttgtgataac
tactatgggacaccaaggttcgcagtagagcaagctattgtggacggtcaggatgttatt
ttagagatagaaatccaaggtgccttacaagttaaaaagcgttttcctcagggagtcttt
accttcatagttcctccttccctcgctgcgctctcagagcggatacataaacggggaact
gagtctgaggaagttattcaaaagcgtttagctactgctatacaggaattggagtatgtc
agtgaatatgactacgttgtggtcaatgatgaaattcctgcggctgttgataaattgaag
agtattattatcgctgaaaaatgtcgggtcaaacgaaaaccgttcgtttttaaggaggaa
tcctaa

DBGET integrated database retrieval system