KEGG   Desulfosporosinus acidiphilus: Desaci_3719Help
Entry
Desaci_3719       CDS       T02148                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desaci_3719
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desaci_3719
Enzymes [BR:dai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Desaci_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3881149..3882084)
Genome map
AA seq 311 aa AA seqDB search
MKLQRKDVLGLEEMDVEEIRQILQTAKVMKGILMRPIKKLPTLKGKSVVNLFYEASTRTR
TSFEMAAKVLGADTTSIAVAQSSVSKGESLYDTAKTIQAMRADLVIIRHSSSGSAGFLAD
ILEAGVINAGDGQHEHPTQALLDIFTMEEKLGDLKGKNVVIVGDVLHSRVARSNAWGLQK
LGVNVTLVGPPTLAPEEMRGLGVKVTHDLDSVLPGADVVMALRLQLERQKSGLFPSLREY
SHLYGLTTERLKKTGKESVIMHPGPMNRGVEISDEVADSAQALIERQVTNGVAIRMALIY
LLIGGSANVVA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcagcgtaaagacgttcttggattagaagagatggacgtggaagaaattcgc
caaatcttacagacggcgaaagtaatgaaaggaattttaatgcgtcctatcaagaagcta
ccaacccttaaaggcaaatctgtcgtcaatctattttatgaggccagcacgaggaccaga
acatccttcgaaatggcggccaaagtcttaggagcggatacaacgagtattgccgtggct
caaagcagtgtgagcaaaggggaaagtttatatgataccgccaaaacgattcaagcgatg
cgggcggatttagtcattatcagacattccagttccggttcggccggttttctggcggat
attttagaggcgggagttattaatgccggagacggtcagcatgaacatccaactcaagcc
ttgttggatattttcacgatggaagaaaaactgggagatttaaagggaaaaaatgtggtc
atcgtgggggatgttttgcattcccgcgtggccaggagcaatgcctggggtcttcaaaag
ctgggagtcaatgtaacattggtgggtccccccacgttggcgcctgaggagatgagggga
ctgggagtaaaggtgacccatgatctcgacagtgttttgccgggtgccgatgtggtcatg
gccctgcgtttacaattggaacgtcaaaaaagcggactgtttcccagtctgagggaatac
agtcatctttatggcttgacaaccgagcgtttgaagaaaacagggaaggaaagtgtcatt
atgcatccgggacccatgaaccggggcgtggaaatttccgatgaggtggcagacagcgct
caggctttaattgaacgccaagttaccaacggtgtagccattcgcatggctttaatttac
ctactgattggagggtctgcaaatgttgttgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system