KEGG   Desulfosporosinus acidiphilus: Desaci_3754Help
Entry
Desaci_3754       CDS       T02148                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00520  Amino sugar and nucleotide sugar metabolism
dai00550  Peptidoglycan biosynthesis
dai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desaci_3754
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desaci_3754
Enzymes [BR:dai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Desaci_3754
Peptidoglycan biosynthesis and degradation proteins [BR:dai01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Desaci_3754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AFM42635
UniProt: I4DA11
Position
complement(3913806..3915071)
Genome map
AA seq 421 aa AA seqDB search
MTMDRYVITGKQRLEGTIHVSGAKNSSLPLLAATLLAEGTSTLLEIPTLADITHMIEVLK
HLGCKVQRQNEGLNIDAAALEFCDVDEELMRKMRASNLILGPLLARYGRVKISRPGGCAI
GTRPMDQHIKGLQQLGVKTKERHGYIEAWADQLEGAEIYLDVPSVGATENIMMAAVLAKG
TTVIRNAAREPEIVDLQNFLNKMGAKVRGAGMDILRIDGVEFLRPAEHIVIPDRIEAGTH
MIAAVMTGGDITIENVVPEHLEPVIAKLRQAGAKITLLDDAVRVQQKGRIRSIDLKTMPY
PGFPTDMQPQFMAMLSCAEGTSVITETIFENRFQHVDELCRMGAQIKVEGRTAIVRGTET
FEGAFVEATDLRAGAALFLAALAADEATVLERVDYIDRGYENLEEKYRHLGAKLLRVTPK
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgactatggatcgctatgtcattacgggaaaacaaagattagaggggacgattcatgta
agtggggcgaaaaactcttcccttccattacttgcggcaactctgcttgccgaagggacc
tcaactttgttggaaattccgacgttggcagatattacacatatgattgaggttttgaaa
caccttggttgtaaagtacaacgtcaaaacgaaggattgaacatagatgccgctgccctt
gaattctgtgatgttgatgaagaactaatgcggaaaatgcgagcttcaaatttgatttta
ggtccccttttagctcgttatgggcgggtcaaaatttcccggccaggtggctgcgctatt
ggaacccggccgatggatcagcatatcaaaggattacagcagcttggagtgaagaccaaa
gagagacatgggtatattgaagcctgggcagaccagttagaaggtgcagaaatttatctg
gatgtaccgagtgtgggggcaactgaaaatataatgatggctgcggttttggccaaagga
accactgtgattcggaacgccgcgcgtgagccggaaattgttgatttgcaaaactttctc
aataagatgggcgctaaagtacgtggggcagggatggatatcctgagaattgacggggtt
gaatttctccggcctgcggagcacatagtgatcccggatcgcattgaagccggtacccat
atgatagctgccgtcatgactgggggggacataaccattgagaatgttgtaccggaacat
ttggagccggtcattgctaaactgcgccaggcaggtgctaagatcaccctcttagatgat
gctgttcgtgtccagcagaaaggcagaattcgcagcatagatcttaaaacaatgccttat
ccgggtttcccgacagatatgcagccacagtttatggctatgctatcatgtgcagaagga
accagtgtcattacggaaacaattttcgaaaaccgcttccaacatgtggatgagctgtgc
agaatgggggctcaaataaaagttgaaggccgaacagccattgtccgtggtactgaaacg
tttgaaggagcttttgttgaggctactgatctaagagcaggggctgccctctttctggcg
gcattagcggctgacgaagcaactgttttggaaagagtcgattatattgatcgcggctat
gaaaacttagaagaaaagtaccggcatttaggcgctaaacttctgagggtcactccaaaa
gtttaa

DBGET integrated database retrieval system