KEGG   Desulfosporosinus acidiphilus: Desaci_4175Help
Entry
Desaci_4175       CDS       T02148                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desaci_4175
Enzymes [BR:dai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Desaci_4175
Peptidases [BR:dai01002]
 Cysteine Peptidases
  Family C44
   Desaci_4175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4322201..4324120
Genome map
AA seq 639 aa AA seqDB search
MCGICGQFGPAKYIDVPRLKQMTRAMKHRGPDQEAYYVSPTLAFGFRRLAIVDIKGGQQP
LSNEDKRIRIIFNGEIYNYKELREHLISHGHSLQQAGDGEVLAHLYEEYGLDFPSKLRGT
FAIALWDERLRRLLLVRDRLGVKPLYVRYNSESLAFASELGALLIGAEKPAINFQALDQY
LSYRYVPAPNTIFRGIYKVPPGTTLLVTFKKGELQVRTKTFWLVPSVKKEISLKEASELV
HTTLKEALQIRWPDEVPAAYYFSGGLDSSGLIAMHQSLYHERARTYAIGFERPHHTRDFR
YYSELDQARNAARVLQTQHCERVVPFAEVQQRLGRILTAMDEPIADPTAIPLYFLSEFAS
SRGEKVVFSGEGADELFGGYSTYLEPSNFRRYHQLPGWTRNILEHTFPQKTERFSLSLSE
RYFGVGGLMRFSQKQSLYSGKMLSALAEEKSYFPTQHLLEDEILSEEERMLQFDMCSWLP
ENTLMKSDKMTMQHGLEIRLPYLDHELVELGMSFPLPYKVTPKESKVVLRRALAGFLPEE
VVTLPKNGFPVPLTAWLMDELKPEVKNVLLDPGARLREFLLPQQIEKMLQADSSHSSRLI
WALYVLEVYLTFWQQAQINVCTRPSAEKNRIPKLGGGSI
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatttgtgggcagtttggcccagctaaatatatcgatgttcctcggctcaaa
caaatgacacgggcgatgaagcatagaggccccgatcaggaagcctattatgtttcaccg
actcttgccttcggatttcgccggttagctattgtggatataaagggaggacagcagccc
ttatcgaacgaagataagcgtatccgcattatctttaatggtgaaatctataattacaag
gaactacgagagcatctgatcagccacggacattccttacagcaggcgggtgatggtgag
gttctggcacacctttatgaggaatatggtttagatttcccctctaaattaagaggaact
ttcgccattgcgctttgggacgagcggcttcgccgcttgttactcgttcgcgatcgttta
ggtgtaaaacccttatatgtccgctataattccgaaagtttagcatttgcttcagaactt
ggagccctgctcatcggagcggagaaaccggctattaattttcaagctttggatcaatac
ttaagttatcggtatgttccggcacctaatacaattttcaggggtatttataaagttccg
ccgggcacaacgttattggtgacctttaaaaaaggcgaacttcaagtacgaacgaaaacc
ttttggctggtcccaagcgtaaaaaaagaaatttcattaaaagaggcgagtgagctcgtc
cacaccaccttaaaggaagccctgcaaattcgttggcctgatgaagtcccggcagcctat
tatttcagcggcggtttggattcgagcggcttgatcgctatgcaccagagtctctatcat
gagcgggcacgaacttacgctattggatttgaacgtcctcatcacacgcgggattttcgt
tattattcggaattagatcaagctcggaatgcagccagagttttacagacgcagcattgc
gaaagggttgtcccttttgctgaggttcagcagcgccttgggcgaatcttaaccgccatg
gatgagccaattgccgatccaacagcaattcctctctatttccttagtgaattcgcctcc
tcgcgaggagaaaaggtcgtcttttcaggagaaggtgccgatgagttatttggcgggtac
agcacctatcttgagccgtcaaacttccgccgctaccatcagcttccaggttggactcga
aacattctggaacatactttccctcaaaagacagaacgcttctccctctcactgagcgag
cgttactttggagttggaggacttatgcgtttctcgcaaaaacaatccctatattccgga
aaaatgctttccgcactagcagaagaaaaatcctattttccgacccaacaccttctggaa
gacgaaatactgtctgaggaggaacgaatgctgcaatttgatatgtgttcatggctgccg
gaaaataccctgatgaaatcggataagatgaccatgcagcacggtttggaaatacggctg
ccctatttggatcatgaactcgttgaattgggcatgagttttccacttccctacaaagtc
actcccaaggaaagcaaggttgtcttgcgcagggcattggcaggcttcttacctgaagaa
gtggtaaccctgccgaaaaatgggttccctgtacctcttacagcctggttaatggacgaa
ctgaaaccagaagtaaagaacgttttattagaccctggagcccgcctgcgggaatttctc
ctgccgcagcaaattgaaaagatgcttcaagctgattcttcccattcgtcacgcctcatt
tgggcgctctacgtattggaagtgtacctaactttctggcagcaagcacaaattaacgtc
tgtaccagaccgagtgcagaaaaaaatagaatccccaaactagggggagggtcaatttga

DBGET integrated database retrieval system