KEGG   Desulfosporosinus acidiphilus: Desaci_4274Help
Entry
Desaci_4274       CDS       T02148                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Desaci_4274
Enzymes [BR:dai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Desaci_4274
Transfer RNA biogenesis [BR:dai03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Desaci_4274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4415854..4416597)
Genome map
AA seq 247 aa AA seqDB search
MNLETLMEEFYTLAIKAGTEIQKIYETNFNIEVKEDKSPLTFADRKSNEIIMTGLKANYS
EYAILSEESRDDKSRLVNDFCFIVDPLDGTKEFINRNGQFTVNIALAYKHKIIIGVIYVP
VTGDLYFASKDYGSYIEKVQNGEISLEKRRLQFTDKVENLIMVSIKSHSSEKDVKLIEVN
NDKIKETVSAGSSLKGCLVASGEADVYYRFGLLRNGIRQLCSVSLKKLGASLDKWMGPRC
FIIGKTS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagaaacattaatggaagaattttatacattggcaataaaagctgggaccgaa
atacaaaaaatttatgagacgaattttaatattgaagttaaagaagacaaatcccctttg
acttttgctgatcgcaaatctaatgaaatcattatgacagggcttaaagctaattattcg
gaatatgcaatattatcggaagaatctagagatgataaaagtcgattagttaatgacttt
tgctttattgttgatccattagatgggacaaaggagtttattaatagaaatggtcaattt
acggtcaacattgcattagcctataagcataagattatcattggtgttatatacgtgcct
gttacgggtgacttatatttcgccagtaaagattatggatcatatatagagaaagttcaa
aacggagaaattagtctggaaaaaaggagacttcaatttacagataaagttgaaaatctt
atcatggtatccatcaagtctcattcatcagaaaaagacgttaagctaattgaagtgaat
aatgacaaaatcaaagagaccgtatcggcaggtagctcactaaaaggctgcttggtagct
tcaggtgaagcagatgtatattatcgtttcggtttacttcggaatgggatacggcagcta
tgcagtgtatcgttgaagaagctgggtgcatctttagacaaatggatgggaccgagatgc
tttataatcgggaaaacatcctga

DBGET integrated database retrieval system