KEGG   Desulfosporosinus acidiphilus: Desaci_4284Help
Entry
Desaci_4284       CDS       T02148                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Desaci_4284
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desaci_4284
Enzymes [BR:dai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Desaci_4284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4426756..4427310)
Genome map
AA seq 184 aa AA seqDB search
MGQIKVSTCPIEGLYIIEPAVHGDSRGYFMETYNQKDMHEAGLDMVFVQDNQSMSVKGVL
RGLHYQKHFPQGKLVRVIRGSVFDVAVDLRHNSATYGIWYGVELTAENKKQFYISEGFAH
GFLVLSDEAEFCYKVTDFYHPGDECGLAWNDPEIGIKWPILEGIELIMSEKDQKWLGLTD
MIKF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggacagataaaagtaagcacatgtccgattgagggactatatataatagagcctgct
gttcatggagacagtagagggtactttatggaaacatataatcagaaggatatgcatgaa
gcaggattagacatggtatttgttcaggataaccagtcaatgtctgtaaaaggagttctg
cgtggtctacattaccagaaacattttcctcagggcaagttggttcgtgtaattcgaggt
tctgtttttgatgttgctgtcgatctgagacacaattcggcaacgtatggtatatggtac
ggtgtggagttgacagcggaaaacaagaagcagttctatatcagtgaggggtttgcgcat
ggttttttggttctatccgatgaagcagaattctgttataaggttactgatttttatcat
ccgggtgatgagtgcggtttagcttggaatgatcctgaaattggaattaagtggccgatc
ctcgagggcatagaactcataatgagtgaaaaggatcaaaagtggctgggattaacggat
atgataaagttctga

DBGET integrated database retrieval system