KEGG   Desulfosporosinus acidiphilus: Desaci_4569Help
Entry
Desaci_4569       CDS       T02148                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dai  Desulfosporosinus acidiphilus
Brite
Enzymes [BR:dai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Desaci_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4771802..4772593)
Genome map
AA seq 263 aa AA seqDB search
MKPKKRLVEPFYFPGNSLGCLLIHGFSGSPSEMRYLGEQLSGLGWTVLGIRLAGHGSTPE
QMAKTRWEDWVRDAEAGVKELRKSCSRVIGIGLSMGGLLVLHLATLDLIDGIVSMNSPML
LADRRTRYVRLIRPFRKFVAKPNSRTNGQIVPEESKSTQQKPERFVYDKIPVDSLISLNK
AIGKVRRELKRIKCPALLMQSRKDFTVDPISVQLISKNINARKSEVLFWEHSGHILTLGP
ERDEVVRKVDGFLQEFNNFNPEI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgaaaaaacgcttagtagagcctttttattttcccggaaattctttagggtgc
ctacttatccatggtttttcgggatcgccttccgaaatgcgctatttaggcgaacaattg
tccggtcttggctggactgtgctgggaataagactcgccgggcatggaagcacaccggag
cagatggcgaagacacgctgggaagactgggtcagggatgctgaagccggtgtgaaggaa
ttaaggaaatcctgttctcgcgtgatcggtatcggcctttcaatgggagggttattagtg
ctccatttggcaacactagacttaattgatgggattgtatcgatgaattctccaatgctg
ttggctgaccgaaggacacgatacgttcgcctgattcgccctttccgaaaattcgtggca
aaaccgaattcgagaactaacggccaaattgtccccgaggaatcgaaatcaactcagcaa
aagccggaacgttttgtctacgataaaattccggtagattcgctgatatccttaaacaaa
gctattggtaaggttcgccgtgaactgaagaggattaaatgcccggccttattgatgcaa
agccgaaaagactttaccgtcgacccaatcagtgttcagcttattagcaagaacattaat
gctcgaaaatccgaagtgcttttttgggagcattcaggacacatattaacacttgggcct
gaacgagacgaggttgtccgaaaggttgacgggtttcttcaggaattcaataactttaat
ccggagatatga

DBGET integrated database retrieval system