KEGG   Desulfosporosinus acidiphilus: Desaci_4573Help
Entry
Desaci_4573       CDS       T02148                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desaci_4573
   01230 Biosynthesis of amino acids
    Desaci_4573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_4573
   00051 Fructose and mannose metabolism
    Desaci_4573
   00562 Inositol phosphate metabolism
    Desaci_4573
Enzymes [BR:dai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desaci_4573
Exosome [BR:dai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desaci_4573
  Exosomal proteins of bladder cancer cells
   Desaci_4573
  Exosomal proteins of melanoma cells
   Desaci_4573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4776132..4776956)
Genome map
AA seq 274 aa AA seqDB search
MDCAPRNKLRASQTKWRNQNVANRRHVIAGNWKMFKTVKEAEDYAVKFLEDVKNVTDLDI
ILCAPFTALYALKNELEESVVHLGAQNMSWADQGAYTGEISAQMLLEAACTYVILGHSER
REMFGETDEAIAKKVRKALEAGLTPILCVGENLSVREAGKAVAQVQGQVAKALEGISPED
LSRVVVAYEPIWAIGTGKTASSQDAQEMCAAIRFTLARFMGTASEKVPILYGGSVKADNI
AELLSESDVDGALVGGASLDPQGFAKLIHNAASV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggattgcgcgccgcgcaacaaacttcgtgcctctcaaacgaagtggaggaatcaaaac
gtggcaaatcgaagacacgtaatcgccggcaactggaaaatgttcaaaactgtgaaggaa
gccgaagattacgcagtaaagtttttagaggatgttaaaaacgttaccgatcttgacatt
attctttgtgctccgtttaccgctctttatgcccttaaaaatgaattggaagaaagtgtt
gtccatttaggtgcccagaatatgtcctgggctgatcaaggcgcctataccggtgagata
tcggcgcagatgcttttggaggcggcttgtacttatgttatcttaggacattccgagcgc
agagaaatgtttggagagaccgacgaagctattgccaagaaagtccgtaaggctttggaa
gcagggctgactcctatcctctgtgtcggcgaaaacctcagtgtccgtgaagcgggaaaa
gctgtcgcacaagtgcagggtcaagtagcgaaggccttagaaggtatttcccccgaagat
ctcagccgggtcgttgttgcttatgaacctatatgggccattggcacagggaaaactgct
tccagtcaggatgcccaagaaatgtgcgcggctattcgttttactctggcgcgttttatg
ggaacagcttcggagaaagtgcccattctttatggcggcagcgttaaggcggataatatt
gctgagttgctttctgagtctgatgttgacggggcactagtcggaggggccagtcttgat
ccccagggtttcgcgaaactaatacataacgcagcttcagtttag

DBGET integrated database retrieval system