KEGG   Desulfosporosinus acidiphilus: Desaci_4573Help
Entry
Desaci_4573       CDS       T02148                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00010  Glycolysis / Gluconeogenesis
dai00051  Fructose and mannose metabolism
dai00562  Inositol phosphate metabolism
dai01100  Metabolic pathways
dai01110  Biosynthesis of secondary metabolites
dai01120  Microbial metabolism in diverse environments
dai01130  Biosynthesis of antibiotics
dai01200  Carbon metabolism
dai01230  Biosynthesis of amino acids
Module
dai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dai_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_4573
   00051 Fructose and mannose metabolism
    Desaci_4573
   00562 Inositol phosphate metabolism
    Desaci_4573
Enzymes [BR:dai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desaci_4573
Exosome [BR:dai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desaci_4573
  Exosomal proteins of bladder cancer cells
   Desaci_4573
  Exosomal proteins of melanoma cells
   Desaci_4573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC DinB_2
Motif
Other DBs
NCBI-ProteinID: AFM43410
UniProt: I4DC86
Position
complement(4776132..4776956)
Genome map
AA seq 274 aa AA seqDB search
MDCAPRNKLRASQTKWRNQNVANRRHVIAGNWKMFKTVKEAEDYAVKFLEDVKNVTDLDI
ILCAPFTALYALKNELEESVVHLGAQNMSWADQGAYTGEISAQMLLEAACTYVILGHSER
REMFGETDEAIAKKVRKALEAGLTPILCVGENLSVREAGKAVAQVQGQVAKALEGISPED
LSRVVVAYEPIWAIGTGKTASSQDAQEMCAAIRFTLARFMGTASEKVPILYGGSVKADNI
AELLSESDVDGALVGGASLDPQGFAKLIHNAASV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggattgcgcgccgcgcaacaaacttcgtgcctctcaaacgaagtggaggaatcaaaac
gtggcaaatcgaagacacgtaatcgccggcaactggaaaatgttcaaaactgtgaaggaa
gccgaagattacgcagtaaagtttttagaggatgttaaaaacgttaccgatcttgacatt
attctttgtgctccgtttaccgctctttatgcccttaaaaatgaattggaagaaagtgtt
gtccatttaggtgcccagaatatgtcctgggctgatcaaggcgcctataccggtgagata
tcggcgcagatgcttttggaggcggcttgtacttatgttatcttaggacattccgagcgc
agagaaatgtttggagagaccgacgaagctattgccaagaaagtccgtaaggctttggaa
gcagggctgactcctatcctctgtgtcggcgaaaacctcagtgtccgtgaagcgggaaaa
gctgtcgcacaagtgcagggtcaagtagcgaaggccttagaaggtatttcccccgaagat
ctcagccgggtcgttgttgcttatgaacctatatgggccattggcacagggaaaactgct
tccagtcaggatgcccaagaaatgtgcgcggctattcgttttactctggcgcgttttatg
ggaacagcttcggagaaagtgcccattctttatggcggcagcgttaaggcggataatatt
gctgagttgctttctgagtctgatgttgacggggcactagtcggaggggccagtcttgat
ccccagggtttcgcgaaactaatacataacgcagcttcagtttag

DBGET integrated database retrieval system