KEGG   Desulfosporosinus acidiphilus: Desaci_4579Help
Entry
Desaci_4579       CDS       T02148                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Desaci_4579
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Desaci_4579
Exosome [BR:dai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desaci_4579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4783647..4785143)
Genome map
AA seq 498 aa AA seqDB search
MKKYVMALDQGTTSCRAILFDKESKIVGITQKEFTQIYPKAGWVEHDPEEIWSTQYGVIA
ELIAKTGIKVDEIASIGITNQRETTVVWDKNTGKPVYNAIVWQCRRTTAICDELKAKGYE
EMVREKTGLVVDAYFSGTKVKWILDNVEGARALAEKGDLLFGTTDTWLIWKLTGGKVHVT
DYSNASRTMMFNIRDLKWDQELLTMLDVPKGMLPEVHNSSEVYGNTDAGIFLGYEIPIAG
VAGDQQAALFGQACYEPGDAKNTYGTGCFMLMNTGSKIHASKHGLLTTIAWGVDGKVEYA
LEGSIFIAGAAIQWLRDGLKMIDVAPDSEYFAKKVKDTDGVYFVPAFVGLGAPYWNMRAR
GGIFGLARGTTKSHIIRAALDSLAYQTKDVLGAMEADSGISLKSLRVDGGAVANNLLMQF
QADILGTKVDRPEIIETTALGAAYLAGLAVGFWSSKEELASRWLLNQRFEPQMEEEKRKK
LYKGWLKAVERTKDWEED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacgttatggcccttgaccaaggtactaccagctgccgagccattctattt
gataaggaaagtaaaattgtagggataacgcaaaaagagttcacgcaaatttatcccaaa
gccggttgggttgaacacgatcccgaggaaatatggagcacccaatatggagttatcgcc
gaactcattgctaaaaccggcataaaagttgatgaaattgcttccattgggataacgaac
caacgtgaaactacggtggtttgggataagaataccggtaaaccggtatataacgccatc
gtctggcagtgccgcagaacaacggccatttgcgatgagctgaaagctaaaggttatgaa
gaaatggttcgggagaaaacaggccttgtggttgacgcctatttttccggaacaaaggtt
aaatggattttagataatgttgaaggagcccgagcactggccgaaaaaggcgacttgtta
tttggcaccacggacacttggttaatctggaaactcacgggcggaaaggttcatgtcacg
gattattccaatgcatcccggaccatgatgtttaatatccgtgatttgaaatgggaccaa
gaattattaacgatgctcgatgtaccgaagggaatgctgcccgaagtgcataattccagc
gaagtttatggcaacaccgatgcaggcattttcttgggttatgagattcctattgccggt
gtggctggcgaccagcaagccgctctgttcggacaagcatgctatgagccgggggatgct
aagaatacctatggaacgggctgtttcatgctcatgaatacagggagtaaaattcatgct
tcaaaacatggtttattgactaccattgcttggggagttgacggcaaagtagagtatgcc
ttagaaggcagtatcttcattgccggggcagcaattcaatggctgcgggacggtctgaag
atgattgacgttgctccggattccgagtattttgcgaaaaaggttaaagatacagatgga
gtttattttgtcccagctttcgtggggttaggcgctccttattggaacatgcgcgctcga
ggcggaatctttggtctggctcggggaactacgaaatcgcatatcattcgggcggctctt
gactccttggcttatcaaacaaaagatgttttaggcgctatggaggccgattccggtatt
tctttgaaatccctgagagttgacggcggtgcagtggccaataatttgcttatgcagttc
caagccgacattttgggaactaaagtcgacagaccggaaattattgagactacagccttg
ggcgcagcctatctcgccggcttggcagttggcttctggtcgagcaaagaggaattggca
agccgctggctgctgaatcaacgcttcgagcctcaaatggaggaagagaagaggaagaag
ctttacaagggttggctaaaagcagttgagaggacgaaagactgggaagaagactag

DBGET integrated database retrieval system