KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0037Help
Entry
DaAHT2_0037       CDS       T01244                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DaAHT2_0037
   01230 Biosynthesis of amino acids
    DaAHT2_0037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DaAHT2_0037
   00051 Fructose and mannose metabolism
    DaAHT2_0037
   00562 Inositol phosphate metabolism
    DaAHT2_0037
Enzymes [BR:dak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DaAHT2_0037
Exosome [BR:dak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DaAHT2_0037
  Exosomal proteins of bladder cancer cells
   DaAHT2_0037
  Exosomal proteins of melanoma cells
   DaAHT2_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
45862..46611
Genome map
AA seq 249 aa AA seqDB search
MRTPLIAGNWKMHLNLDQAAELAAAVAGVAEACPDREVMIAPPFTALARVREVAGERLIL
AGQNVCWEEKGAFTGEIAPPMLRELGCRMAIVGHSERRHVFGEDDAMVNRRLRGAMAHGL
VPILCIGETLDEREAGQTMAVLERQVRDGLQQVEISEAAGLVIAYEPVWAIGTGKTASPD
QAQEAHEFVRRLLCEVYEKNIAAGIRILYGGSVNAANVDEIMAQADVDGALVGGASLSAE
TFERIIRFA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccccgctgattgccgggaactggaagatgcacctgaacctcgatcaggccgcc
gagctggcggcggcggtggccggggtggcggaggcttgccccgaccgggaagttatgatc
gcgccgcccttcaccgccctggcccgggtgcgggaggtggccggggaacggctgatcctg
gccggccagaacgtctgctgggaggagaaaggcgcctttaccggcgagattgccccgccc
atgctgcgcgagttgggttgccggatggcaatcgtcggccactccgagcgccgccacgtc
ttcggcgaagacgatgccatggtcaaccgccgcctgcgcggggccatggcccacggcctg
gtgcctatcctctgcattggcgagaccctggatgagcgggaggccggccaaaccatggcg
gtgctggaacggcaggtgcgggatggtctgcagcaggtggaaatcagcgaggccgccggc
ctggtgatcgcctatgaaccggtttgggccatcggcaccggcaaaaccgccagccccgac
caggctcaggaggcccatgaatttgtgcgccgattgctttgcgaggtctatgagaaaaat
attgccgccggcatcagaatactgtatggtggcagcgttaatgccgccaatgttgatgaa
atcatggcccaggcggatgttgacggtgccctggtcggcggcgcgtcattgtcggccgaa
acttttgagcgcatcatccgctttgcttaa

DBGET integrated database retrieval system