KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0138Help
Entry
DaAHT2_0138       CDS       T01244                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dak  Desulfurivibrio alkaliphilus
Brite
Enzymes [BR:dak01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     DaAHT2_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
166978..168021
Genome map
AA seq 347 aa AA seqDB search
MKRFYALFVGGALLLAGAVGVAMASGHGLASYKDNFEPITVMYVDNPDNPVTPEKVELGR
KLYHDPRLSKSGLFSCNTCHNIATWGMSKLPVDIGHQWRLGPVNSGTVFNAAFYEAQFWD
GRAADLEEQAKGPILAHEEMAMPSEELAVERIASIPEYVSRFKVSFPEDAEPLTYDNIAN
AIAAFERTLLTPGRWDRFLLGDNDSLSRAEHEGMKAFVDMGCARCHNGVALGGGFEKMGL
VNNYPSESPSQGRYDVTGKQEDKNVFKMTTLRNIEHTYPYFHDGAVWELEEAVRIMARLQ
LGRQLNDAETKSIVTFLKALTGEIPEHALRLPVLPASTAATPRPDPS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtttttatgccctgtttgtcgggggagctctactgttggccggcgccgtcggt
gtggccatggcttccggtcatggtctggctagctacaaggacaacttcgagcccattacc
gtgatgtatgtcgacaatcccgataacccggtgacccctgaaaaagttgagctggggcgc
aagctctaccatgaccctcggctttccaagagcggccttttcagttgcaacacctgccat
aacatcgccacctggggcatgagcaagctgccggtggatattggccaccagtggcggctg
gggccggtcaactccggtaccgtgttcaacgccgccttttacgaggcacaattttgggat
ggccgggccgcagacctggaagagcaggccaaaggaccgattcttgcccatgaggaaatg
gccatgcccagcgaagaactggcggtggagcggatcgcctccatccctgagtatgtcagc
cgctttaaagtctctttccccgaggacgcggaacccttgacctacgataacatcgccaac
gccatcgctgctttcgagcgtaccctgctgactcccggccgttgggaccgcttcctgctg
ggagataatgactccctgagccgggccgaacatgaaggcatgaaggcctttgtcgacatg
ggctgcgcccgttgccataatggagtagccttgggcggcggttttgaaaaaatgggcctg
gtcaacaattacccctcggaaagtcccagccaggggcgctatgacgtcaccggtaagcag
gaggataaaaatgttttcaagatgaccaccctgcgcaacatcgagcacacctacccctac
ttccacgacggggcggtctgggagctggaggaagcggtacggatcatggcccggctccag
ttgggccgccagctgaacgatgctgagaccaaaagcattgtcaccttccttaaggcgctg
accggcgaaatccccgagcacgccctgcggctgccggtgctgccggcctccaccgccgcc
accccacgccccgatcccagctaa

DBGET integrated database retrieval system