KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0346Help
Entry
DaAHT2_0346       CDS       T01244                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DaAHT2_0346
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DaAHT2_0346
Exosome [BR:dak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DaAHT2_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
403799..404767
Genome map
AA seq 322 aa AA seqDB search
MIYPDYRPRRLRRNENLRSLVRETVLTPAQLIYPLFVMPGKNKREEISSMPGVFRLSVDQ
LAKEAKECRKLGVNHVILFGLPEKKDRVGSGAHATDGIIQRAIKELKNKAPELTVSTDVC
LCEYTSHGHCGIIHEGMVDNDATVEVLARTALSHAKAGADIVAPSDMMDGRVGEIRAALD
EHNFDQVAIMSYAVKYASAFYGPFRDAADCAPQEGDRRGYQMDPANAREALREATLDVEE
GADILMVKPGMPYLDIIRLLRDEFDHPIAAYQVSGEYAMLKAAAINGWLDEERVMAESLL
SLRRAGADMILTYFAKQMAKLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcccgattatcgcccccggcgcctgcggcggaatgaaaacctgcgctccctg
gtgcgggaaacggtgcttaccccggcccagttgatctaccccctctttgtgatgcccggc
aagaacaagcgcgaggagatctcctccatgcccggggtcttccggctgtcggtggatcag
ttggccaaagaggctaaagagtgccgcaagctgggggtcaaccatgtcattcttttcggt
ttgccggaaaaaaaagaccgggtgggctccggggcccatgccaccgatggcattatccag
cgggccatcaaggagctcaagaacaaagcgccggaactgacggtctccaccgatgtctgc
ctgtgcgaatataccagccatggtcattgcgggattattcatgaaggcatggtggacaac
gatgccaccgtcgaggtgctggcccgtaccgccctgtcgcatgccaaggccggggccgat
atcgtcgccccgtcggacatgatggacggccgggtgggggagatccgggccgccctggac
gaacacaacttcgaccaggtggccatcatgtcttacgccgtcaagtacgcctcggccttt
tacggccccttccgggacgccgccgactgcgccccccaggagggtgaccgccgggggtat
cagatggacccggccaatgcccgggaggccctgcgtgaggccaccctggatgtggaagag
ggggccgacatcctgatggtcaagccggggatgccctacctcgatatcatccggctgctg
cgcgatgaattcgaccaccccattgccgcctaccaggtcagcggcgagtacgccatgctc
aaggccgccgccatcaacggctggctcgacgaagagcgggtgatggccgaaagtctgctc
tctttgcgccgggccggggccgatatgattctgacttattttgccaagcagatggccaag
ttgttgtaa

DBGET integrated database retrieval system