KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0346Help
Entry
DaAHT2_0346       CDS       T01244                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00860  Porphyrin and chlorophyll metabolism
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DaAHT2_0346
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DaAHT2_0346
Exosome [BR:dak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DaAHT2_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADH85052
JGI: DaAHT2_0346
UniProt: D6Z6U3
Position
403799..404767
Genome map
AA seq 322 aa AA seqDB search
MIYPDYRPRRLRRNENLRSLVRETVLTPAQLIYPLFVMPGKNKREEISSMPGVFRLSVDQ
LAKEAKECRKLGVNHVILFGLPEKKDRVGSGAHATDGIIQRAIKELKNKAPELTVSTDVC
LCEYTSHGHCGIIHEGMVDNDATVEVLARTALSHAKAGADIVAPSDMMDGRVGEIRAALD
EHNFDQVAIMSYAVKYASAFYGPFRDAADCAPQEGDRRGYQMDPANAREALREATLDVEE
GADILMVKPGMPYLDIIRLLRDEFDHPIAAYQVSGEYAMLKAAAINGWLDEERVMAESLL
SLRRAGADMILTYFAKQMAKLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcccgattatcgcccccggcgcctgcggcggaatgaaaacctgcgctccctg
gtgcgggaaacggtgcttaccccggcccagttgatctaccccctctttgtgatgcccggc
aagaacaagcgcgaggagatctcctccatgcccggggtcttccggctgtcggtggatcag
ttggccaaagaggctaaagagtgccgcaagctgggggtcaaccatgtcattcttttcggt
ttgccggaaaaaaaagaccgggtgggctccggggcccatgccaccgatggcattatccag
cgggccatcaaggagctcaagaacaaagcgccggaactgacggtctccaccgatgtctgc
ctgtgcgaatataccagccatggtcattgcgggattattcatgaaggcatggtggacaac
gatgccaccgtcgaggtgctggcccgtaccgccctgtcgcatgccaaggccggggccgat
atcgtcgccccgtcggacatgatggacggccgggtgggggagatccgggccgccctggac
gaacacaacttcgaccaggtggccatcatgtcttacgccgtcaagtacgcctcggccttt
tacggccccttccgggacgccgccgactgcgccccccaggagggtgaccgccgggggtat
cagatggacccggccaatgcccgggaggccctgcgtgaggccaccctggatgtggaagag
ggggccgacatcctgatggtcaagccggggatgccctacctcgatatcatccggctgctg
cgcgatgaattcgaccaccccattgccgcctaccaggtcagcggcgagtacgccatgctc
aaggccgccgccatcaacggctggctcgacgaagagcgggtgatggccgaaagtctgctc
tctttgcgccgggccggggccgatatgattctgacttattttgccaagcagatggccaag
ttgttgtaa

DBGET integrated database retrieval system