KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0367Help
Entry
DaAHT2_0367       CDS       T01244                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DaAHT2_0367
   00052 Galactose metabolism
    DaAHT2_0367
   00500 Starch and sucrose metabolism
    DaAHT2_0367
   00520 Amino sugar and nucleotide sugar metabolism
    DaAHT2_0367
Enzymes [BR:dak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DaAHT2_0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(426255..427127)
Genome map
AA seq 290 aa AA seqDB search
MKVRKAVIPVAGLGTRFLPASKAIPKEMLTIVDRPTIQYIVEEVVNSGIEVIIFVTSEGK
SAIENHFDYDFELDTMLRQKNKPELYEEVRHISNLIDIIAVRQKKPLGLGHAIWSARNVV
GHEPFLVLLGDDLVLSDNLPCCRQMLNLYDEVQESIVAIQRVAPEETGQYGIVEGEPVRD
RVHKVQRMVEKPPPGTTDSDLAIIGRYLLQPDIFDLLQTTTPGHGGEIQLTDALMALARK
RPLYAYEFEGTRFDAGDKLGYLKAIIAFARCHPTLGPEFRQHLKEVCAAL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttcgcaaggccgtaattcccgtcgccgggctgggcacccgttttctgccggcc
agcaaggccatccccaaagagatgctgaccatcgtcgaccggcccaccatccagtatatc
gtggaggaggtggtcaattccggcatcgaggtgatcatctttgtgaccagcgaaggcaag
tcggccattgaaaaccacttcgattacgacttcgagctggacaccatgctgcgccagaaa
aacaagcccgaactgtacgaagaggtgcgccatatctccaacctcatcgacatcatcgcg
gtgcgccagaaaaaaccgctggggctggggcatgccatctggagtgcccgcaacgtggtg
ggccacgagcccttcctggtgctgctgggcgacgacctggtgctttccgacaacctgccc
tgctgccggcagatgctcaacctctatgacgaagtgcaggagtccattgtggccatccag
cgcgtggccccggaggaaaccggccagtacggaatcgtcgagggcgaaccggtccgggac
cgggtgcacaaggtgcagcggatggtggaaaaaccaccccccggcaccaccgattccgac
ctggccatcatcggccgctacctgctgcagccggacatctttgacctgctgcagacaacc
acccccggccacggcggcgagatccagctcaccgacgccctgatggccctggccagaaag
cggccattatacgcctacgagtttgaaggcacccgttttgacgccggcgacaagctgggc
tacctgaaagcgatcatcgcctttgcccgctgccatcccaccctgggcccggaattccgc
caacacctcaaggaggtttgcgcggccctttaa

DBGET integrated database retrieval system