KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0536Help
Entry
DaAHT2_0536       CDS       T01244                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00860  Porphyrin and chlorophyll metabolism
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01120  Microbial metabolism in diverse environments
Module
dak_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DaAHT2_0536
Enzymes [BR:dak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     DaAHT2_0536
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DaAHT2_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase B12-binding tRNA_bind_3
Motif
Other DBs
NCBI-ProteinID: ADH85242
JGI: DaAHT2_0536
UniProt: D6Z0L3
Position
635879..637405
Genome map
AA seq 508 aa AA seqDB search
MSKKGKVYLVGAGPGDPELITVKGKRLLGRAEVVVYDYLANKKLLAHVPPTAVLIYAGKK
GGSTHTHSQTEINQMLVDHALGGKTVVRLKGGDPFIFGRGGEEIEELSAHGVPFEVVPGV
TSASAAATYAGVPITHRAFTSSVAFITGHEDPNKKESRIAWDKLATGVGTLVFYMGIKNL
PNIVANLIKHGRDPQTPVAVVRWASTPEQRSVVGTLASISEVVRQAGITPPALVVVGEVV
SLREVINWYEKRPLFGKKILVTRSREQASELVQSLEDLGADCLEGSTIALAEPPDWAPLD
QALDKIATYNWLLFTSPNAVNFFFKRLAALGLDSRRLHGPQIAVVGTATAEALQNYGIKA
DLLPARFTAEGLAEALLAQGVSGRKILLPRALKAREVLPESLRAAGAEVDIAPVYQNTRP
PMADEIRQALERQEVDLITFTSSSTASNLFALLNWPAEELARRLAGVKIAAIGPITAATV
EKAGLKVDIQPETHTIPEMVSAIAAYYL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaaggggaaggtttatctggtgggggccggtcccggcgacccggaactgatc
accgtcaagggtaaacgcctgttggggcgggccgaggtggtggtttatgactacctggcc
aataaaaaattgctggcccatgtaccgccgacggctgttttaatctatgccggcaaaaag
gggggtagcacccatacccacagtcagactgaaatcaaccagatgctggtggaccatgcc
ttgggcgggaaaaccgtggtgcggcttaaaggtggtgatcccttcatctttggccggggc
ggggaagagatcgaagagctgtccgcccatggggtgcctttcgaggtagtgcccggggtg
acctccgccagtgccgccgccacctacgccggggtgcccatcacccatcgcgcttttacc
tcttcggtggccttcatcaccgggcatgaggatcccaacaaaaaggaaagccggatcgcc
tgggataagctggccaccggggtgggtaccctggtgttttacatgggcatcaaaaacctg
cccaatattgtcgccaacctgatcaagcacggccgggacccgcagactccggtggcggtt
gtgcgctgggcctccaccccggagcagcgttcggtggtgggaacactggctagtattagc
gaagtggtgcgccaggccggcatcaccccgccggctttggtggtggtgggtgaggtggtg
agcctgcgggaggtgatcaactggtatgaaaagcggccgttgtttggcaaaaagatcctg
gttacccgcagccgggagcaggccagcgaactggtgcaaagcctggaggatctgggggcc
gactgcctggaaggctccaccatcgccctggccgaaccaccggactgggccccgctggac
caggctttggataaaatcgccacctataactggctgctcttcaccagccccaacgcggtg
aactttttctttaagcggctggcggccttgggcttggacagccgccgcctgcacggcccg
cagattgccgtggtgggtacggccaccgccgaggcgttgcaaaactacgggatcaaggcc
gacctgctaccggccaggttcaccgccgaaggcctggccgaggccctgctggcccagggg
gtgtccggccggaagatcctgctgccgcgggccctgaaggctcgcgaggtgctgccggaa
agcctgcgcgccgccggcgccgaagtggatatcgccccggtttaccagaacactcgtcct
cccatggccgatgagattcgccaggccttggagcggcaagaggtggacctgatcaccttt
accagttcctcaacagccagcaatctctttgcgttgctcaactggcccgccgaggaactg
gccaggcgcctggccggggtcaagatcgccgccatcggtccaatcaccgccgccacggtg
gagaaggccggcctcaaggtagacattcagcccgagacccataccatcccagaaatggtc
agtgccatcgccgcttattatttgtga

DBGET integrated database retrieval system