KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0599Help
Entry
DaAHT2_0599       CDS       T01244                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DaAHT2_0599
Enzymes [BR:dak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DaAHT2_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
709693..710565
Genome map
AA seq 290 aa AA seqDB search
MSSSPAERKLAIQAPAKINYYLRILGKRPDGYHELDSLMIKLELADDLVLRRRSTAGIEV
RCPGKEVPTGPANLVYQAAAAFFAHCRLDPALEITLTKRIPVAAGLGGGSSDAAAVLRGL
DQLYGTGLGLEQLQALARPLGADVPFFVQPEPAARARGIGEQLTPVPVPAGVNWIVLVNP
GFGVSTKWVYDNFPLTKQSDPANFTGSSAAEALPPHNDLEAVTLAGYPELATIRRQLLAA
GASAALMSGSGPTMFAVFAEEPAARACAAGMARQYRKVYVTRPCWGVVKR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctcacccgctgagcgtaaactggcaatccaggcgccggccaagatcaactac
tatctgcgtattctgggcaaacggcccgatgggtaccacgagcttgattccctgatgatc
aagctggaactggccgatgatctggtattgcggcgccggtcgaccgccgggattgaagtg
cgctgcccgggcaaagaagtgccgaccgggccggctaacctggtgtatcaggcggcggcg
gccttttttgcccattgccgtcttgacccggcccttgaaatcactttaaccaagcgaatc
ccggtggccgccggtctgggcgggggcagcagtgatgccgccgccgtgctgcgggggctg
gaccagctttatggcaccggtttggggctggagcagttgcaggccctggcccggccgctg
ggggccgatgtgcctttctttgttcagccggaaccggcggcccgggcccggggcatcggt
gagcagttgacgccggtgccggtgccggccggggtcaactggatcgtgctggtcaatccc
ggcttcggggtctccaccaagtgggtttatgacaactttccattgacaaaacagagcgat
cccgctaactttaccggctcttcagcggcggaggctttgcccccccataacgacctggag
gccgtgaccctggccggttatcccgagttggcgaccattcgtcggcaactgttggcggcg
ggggcttcagcggccctgatgtccggcagcggccccaccatgttcgccgtttttgctgaa
gagccggcggcccgggcctgcgctgccggcatggctcggcaataccgaaaagtttatgta
accagaccctgctggggcgtcgtcaagcggtaa

DBGET integrated database retrieval system