KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0642Help
Entry
DaAHT2_0642       CDS       T01244                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DaAHT2_0642
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DaAHT2_0642
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DaAHT2_0642
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DaAHT2_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
756157..757548
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGGIAPIPFSEAVMMGLADDGGLLLPEKLPQATGEEIAVWRRLNYPDLAVAVLS
HFIDDIPAADLERLVKKSYAAFQHPEVTPVVKQGQCHILELFHGPTLAFKDVALQLLGNL
FEYLLAKSGGRMNIIGATSGDTGSAAIYGVRGKERINIFILHPHGRVSPIQEKQMTTVLD
ANVFNIAVKGTFDDGQAIVKKLFGDLNFKQQHQLGAINSINWARIVAQVVYYVYAALKLT
GEGKAAQVDFAVPTGNFGDIFAGFVARRLLPKQIGQLILATNENNLLTRFVKDGDYSVSG
VRPTSSPSMDIQVASNFERYLYYLNDQDAQRTRQEMEQFAATGSLQFDPARLQRIQQDFA
SQSADEAATKATIGDFYQSHDYLLDPHTAVGVYAGLACRRPEVPLVCLATAHPAKFGQAV
EAAIGRPPELPPPLAALAKLESRCQVLPAEEQVIKDFVAQHAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatttcaaccaggggtggcatcgcccccatccccttcagtgaagcggtaatg
atgggcctggctgacgacggcggcctgctgctgccggaaaagctgccccaggccaccggc
gaggagatcgccgtctggcgccgcttaaattacccggacctggcggtggcggtgctcagc
cacttcatcgacgatatccccgccgccgacctggagcggctggtaaagaaatcctacgcc
gctttccagcatcccgaagttaccccggtggtcaagcagggccagtgccacatcctggaa
cttttccacggcccgaccctggcctttaaagacgtggccctgcaactgctgggcaacctc
tttgaatatctgctggccaagtccggcggccggatgaacatcatcggggccacctcgggc
gataccggcagtgccgccatctacggggtgcggggcaaggagcggatcaacatctttatt
ctccatccccacgggcgggtcagccccatccaggaaaagcagatgaccacggtgctggat
gccaatgtgttcaacatcgccgttaaaggcacctttgatgatggccaggccatcgtcaaa
aaactcttcggcgacctgaacttcaagcaacagcaccagcttggggccatcaactccatc
aactgggcccggatcgtggcccaggtggtctactacgtttacgccgccctcaaactcacc
ggcgagggcaaggcagcgcaggtggattttgccgtgcccaccggtaatttcggcgatatc
ttcgccggctttgtcgcccggcggttgctgccaaagcaaatcggtcaactgattctggcc
accaacgaaaacaacctgctcacccgcttcgtaaaggacggcgactactcggtcagcggc
gtgcggcccacctccagcccctccatggatatccaggtggccagcaacttcgaacgctat
ctgtattatctcaacgaccaggacgcccagcgcacccggcaggagatggaacaattcgcc
gccaccggcagcctgcagtttgaccccgccaggctgcagcgcatccagcaggattttgcc
tcgcaaagcgccgacgaggccgccaccaaagccaccattggcgacttctaccagagccat
gattacctgctggacccccacaccgccgtgggggtttacgccggcttggcctgccgccgg
ccggaggtccccctggtctgcctggccaccgcccatcccgccaagttcggccaggcggtg
gaggcagccatcggccggccgccggagctgccgccgccgctggcggcccttgcaaaactg
gaaagccgatgccaggtgctgccggccgaggaacaggtaatcaaggacttcgtcgcccag
cacgctctgtga

DBGET integrated database retrieval system