KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0702Help
Entry
DaAHT2_0702       CDS       T01244                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DaAHT2_0702
Enzymes [BR:dak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DaAHT2_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
835323..836255
Genome map
AA seq 310 aa AA seqDB search
MVYLKAMQTSMVYPRFLEDEADVGVVCPRFAVLSAPMAPTVSWGGGTEAGPAAILEASTA
LEVFDDELLQETVQAGIVTRPPLPLAGHDLTDDCRLIKEAVSRELAAGLFPVLLGGEHTV
SGPAVAAMQEQYPDLHVVQVDAHLDLRDAYSGTPLSHACVMRRVAELGVNFSQVGIRSFS
AEEWQLVQQHGWQPYTMARIHQQPDWLEQLQGEINGPVYLTIDVDGLDPAIMPATGTPEP
DGLSWRQVTALIRMLTAIKPGLVGLDVVELAPRPGQEHAAFTAAKLIYRTMGYIAAKEVA
ATHGHGPKQV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtttatttaaaggccatgcaaacatccatggtttatccccgttttctcgaagatgag
gctgatgttggggtggtctgcccccgctttgccgtgctctccgctcccatggcgccgacc
gtcagttggggaggggggaccgaggccggtccggcggcgattctggaagcctcgacggca
cttgaggtgttcgacgatgaactgctgcaggaaaccgttcaggccgggattgttacccgt
ccacctttgcctttggcggggcatgatttaaccgatgactgccgactgatcaaggaagcg
gtgagcagggagcttgccgccggtcttttcccggtgctgctgggcggtgaacacaccgta
agcggcccggcggtggctgccatgcaggagcaataccccgacctgcacgtggtccaggtt
gatgcccacctcgatctgcgtgatgcctacagcggcacccccttgagccatgcctgcgtc
atgcggcgggtggccgagctgggagttaacttcagccaggtcggcattcgctctttttcg
gctgaagagtggcaactggtgcagcaacacggctggcaaccctataccatggccagaatt
catcagcagccggactggttggagcaactgcagggggagatcaacgggccggtatatctt
accatcgatgtggacggcctggacccggccatcatgccggccaccggcaccccggaaccc
gacggcctgtcctggcgccaggtgaccgcgctgattcgtatgctgaccgccattaagccg
ggcctggtgggcctggacgtggtggagctggcaccccggccggggcaggagcacgccgcc
tttaccgccgccaagttgatctaccggaccatggggtatatcgctgcaaaagaggtggcg
gcaacccatggccatgggccgaaacaagtataa

DBGET integrated database retrieval system