KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0715Help
Entry
DaAHT2_0715       CDS       T01244                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dak00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DaAHT2_0715
Enzymes [BR:dak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DaAHT2_0715
DNA repair and recombination proteins [BR:dak03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DaAHT2_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD DUF2075 T2SSE AAA_23 UvrD-helicase Herpes_Helicase PhoH ResIII AAA_22 DEAD PIF1 UvrD_C Flavi_DEAD Mg_chelatase AAA_29 NTPase_1 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADH85419
JGI: DaAHT2_0715
UniProt: D6Z1G4
Position
851848..853755
Genome map
AA seq 635 aa AA seqDB search
MGPEMAQLMERLVKEEVLAEFDRHWLELLARLQPQSSPALLLTAALLRRAVDLGHVCLKL
PEVAAWWPAEAAAMGYAAPSPSTLLAELRHSALVDSLEPGACSHLQGATEHGPPQVAVAP
LVLSDNRLYLRRYWQYEMALADEIRARAVRVPAPPAPEVAAARLAELATAAGVELDQDQQ
AAVLGALNHYLTVISGGPGTGKTTIIFFILTLLTQMAREEGQGSDLRVLLLAPTGKATAR
LAETLRERAAEFSAMTIHRALGYQSCSPTIFRHNRSNPLAADLVVVDEASMVDLALMSKL
FAAVSPRARLVLLGDKDQLASVEAGSILGDICLAAPQLDSAVIELSREFRFDPRRGIGAL
VRGIKAGEPATVLAVPVRVDGAQNDDPKGPPAEVTLSDQPGAPAENPTLRELVLAGFRPC
LQASSPAEALARMNDFRLLCAHRRGPYGVEQLNSFCRQLLRAEGVLGEAAGRGAMGKEAR
GPADGLAPEGDYYRGQPVLVVANSYESRLFNGDLGIIWPSPDDAGQLMAFFPSAQGAPRM
LPPGRLPRHETAFAMTIHKSQGSEFNQVAVVLPPEDSPLLSRELLYTAVSRARSRVHLFG
PEQVLSRAVDRRVTRASGLAEILTRTENGHISAPI
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggaaatggcccaactgatggaacgcctggtcaaggaagaggtgctggccgag
tttgaccggcactggcttgaactgctggcccggctgcaacctcagagctcccccgccctg
ctgctgacggcggccttgctgcgccgggccgtggatttgggccacgtctgccttaagctg
ccggaggtggcggcctggtggccggcggaagccgcggccatgggttatgccgccccctcg
ccgtcgaccctgctggccgagttgcgccacagtgccctggtggacagcctggagcctggc
gcgtgcagccatcttcagggcgcaaccgagcacgggccaccacaggtcgcggtggcccct
ctggtattgagcgacaaccggctttatctgcggcgctactggcagtacgaaatggccctg
gccgatgagatcagggcaagggcggtaagggtacccgcgccgccggcgccggaggttgcc
gccgcccgcctggccgaactggcgacggcagcaggggtggaactggaccaggaccagcag
gcggcggtactgggggcgctcaaccattatctaaccgtgatttccgggggaccgggaacc
ggcaagaccaccattatcttttttatcctgaccctgctgacccaaatggccagagaagag
ggacaggggagcgatttgcgggtgctgctgctggcccccaccggcaaggcaacagctcgc
ctggcggagaccctgcgggaacgagcggcggagttttccgccatgaccatccaccgggcc
ttggggtatcaaagctgttcccccaccattttccgccataaccggagcaacccgctggcg
gccgacctggtggtggtggacgaggcctccatggtggacctggccctgatgagcaaactg
tttgccgccgtatctccccgggcccggttggtgctgctgggcgacaaggaccaactggcc
tcggtggaggccggctccattctgggcgatatctgtttggccgccccgcagctggactcg
gcggttattgagttgagccgggagttccgctttgatcctcggcggggtatcggcgccctg
gtgcgagggattaaggcgggagagccggccacggtactggcggtgccggtgcgggtggat
ggcgcccaaaatgatgaccccaaagggccgccagcagaggttactttaagtgaccaaccc
ggcgctccggcggaaaaccccaccttgcgcgagttggtgctggccggtttccggccttgc
ctgcaggcctcttccccggccgaagccctggccagaatgaatgacttccgcctactctgc
gcccatcgccggggaccatacggggtcgagcaactcaacagcttttgccggcaactgctg
cgggcggaaggagtgctgggagaggcggcaggccgtggggcaatgggaaaggaggccaga
gggccggcggacggactcgctccggaaggggattattatcgggggcaaccggtgctggtg
gtggccaacagctacgaaagccggctgttcaacggcgatctgggcattatctggccgtcg
ccggacgacgccggccaactgatggcctttttcccgtccgcccagggggcgccccgaatg
ctgccgccggggcggttgccccgccacgaaaccgcctttgccatgaccattcataaaagc
cagggttcggagttcaaccaggtggcggtggttctgcctccggaagactcacccctgctc
agccgggagctgttgtacacggctgtctcccgggctcgcagccgggttcatctcttcggc
cccgagcaggtgctcagccgggccgttgaccgccgggtaacccgcgcctccggcctggcc
gaaattttaaccaggaccgaaaacggccatatcagcgcaccaatataa

DBGET integrated database retrieval system