KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0908Help
Entry
DaAHT2_0908       CDS       T01244                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DaAHT2_0908
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DaAHT2_0908
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DaAHT2_0908
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DaAHT2_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1095350..1096696)
Genome map
AA seq 448 aa AA seqDB search
MKQKHILLPPDQQVKSWYNVVADLPGGLAPPLDPATGQPMGPDKMGAIFPMGLLEQEMSQ
QRWIDIPREILEIWQIWRPSPLIRATFLEEALGTKAKIYYKYEGVSPSGSHKTNSAVAQA
YYNKQEGVKRLATETGAGQWGCALSFAAHKFGLDCKVYMVRVSYDQKPYRKVMMNTYGAE
IVASPSPDTPTGREVLAKTPDTPGSLGIAISEALEDTVSRDDTKYALGSVLNHVCLHQTV
IGLEAKQQLALVGDYPDVVIGCCGGGSNFAGLAAPFVPDKLEGKNIRLLGVEPASCPTLT
KGSFAYDFGDLSQRTPLLYMYTLGHDFIPPGIHAGGLRYHGMAPVISALMREKLMEATAL
QQLECFEAGTLFARTEGIIPAPESCHAVRAAIIEATREPDKPQTILFNLSGHGLLDLASY
EKYFAGELVNYEMPDEAIAEATKNLPKL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaacacattcttttgcctccggatcagcaagtaaaaagctggtataacgtt
gttgccgacctccccggtggtctggctccccccttggatccggccaccggccagcccatg
gggccggacaagatgggggcgatttttcccatggggctgctggagcaggagatgagtcag
cagcgctggatcgatattccccgggaaattcttgaaatctggcagatctggcgcccttcg
cccttaatcagggccaccttcctggaagaggccctggggaccaaggcgaaaatttattac
aaatatgagggggtatctccttccggcagccacaaaaccaacagtgccgtggcccaggcc
tattacaacaagcaggagggggttaaacggctggccaccgaaaccggcgccggccagtgg
ggttgcgccctctcttttgccgctcacaaattcggcctggactgcaaggtctacatggtt
cgggtttcctatgaccagaaaccctaccgcaaggtaatgatgaacacctacggggccgaa
atcgtggccagccccagccccgatacccccaccggccgcgaagtgctggccaaaaccccg
gacaccccgggctctttggggatcgccatcagtgaggccctggaggacacggtgagccgg
gacgacaccaagtacgccctggggtcggtcttaaaccatgtctgcctgcaccagacggtg
atcggcctggaggccaagcagcaactggccctggtgggggattatcccgatgtggtgatc
ggctgttgcggcggcgggtccaacttcgccggcctggccgccccgtttgtacccgataag
ctggaaggaaaaaatatccgcctgctgggggttgagccggcctcctgcccaaccctgacc
aaggggagttttgcctatgattttggcgatctttcccagcgtacgccgcttttgtacatg
tacaccctggggcatgatttcatcccccccgggattcacgccggcggtctgcgctaccat
ggcatggccccggtgatcagcgccctgatgcgggaaaaactgatggaagccaccgccttg
cagcagttggagtgctttgaggccggcaccctgtttgcccgcactgaaggcattatcccg
gccccggaatcctgccatgcggtccgggcggcgatcattgaagccacgcgggagccggat
aagccccagaccattctcttcaacctctccggccacggcctgctggatctggccagctac
gaaaaatacttcgccggtgaactggtcaactacgaaatgcccgacgaggccattgccgag
gccaccaaaaaccttcccaaactgtaa

DBGET integrated database retrieval system