KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0908Help
Entry
DaAHT2_0908       CDS       T01244                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DaAHT2_0908
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DaAHT2_0908
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DaAHT2_0908
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DaAHT2_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1095350..1096696)
Genome map
AA seq 448 aa AA seqDB search
MKQKHILLPPDQQVKSWYNVVADLPGGLAPPLDPATGQPMGPDKMGAIFPMGLLEQEMSQ
QRWIDIPREILEIWQIWRPSPLIRATFLEEALGTKAKIYYKYEGVSPSGSHKTNSAVAQA
YYNKQEGVKRLATETGAGQWGCALSFAAHKFGLDCKVYMVRVSYDQKPYRKVMMNTYGAE
IVASPSPDTPTGREVLAKTPDTPGSLGIAISEALEDTVSRDDTKYALGSVLNHVCLHQTV
IGLEAKQQLALVGDYPDVVIGCCGGGSNFAGLAAPFVPDKLEGKNIRLLGVEPASCPTLT
KGSFAYDFGDLSQRTPLLYMYTLGHDFIPPGIHAGGLRYHGMAPVISALMREKLMEATAL
QQLECFEAGTLFARTEGIIPAPESCHAVRAAIIEATREPDKPQTILFNLSGHGLLDLASY
EKYFAGELVNYEMPDEAIAEATKNLPKL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaacacattcttttgcctccggatcagcaagtaaaaagctggtataacgtt
gttgccgacctccccggtggtctggctccccccttggatccggccaccggccagcccatg
gggccggacaagatgggggcgatttttcccatggggctgctggagcaggagatgagtcag
cagcgctggatcgatattccccgggaaattcttgaaatctggcagatctggcgcccttcg
cccttaatcagggccaccttcctggaagaggccctggggaccaaggcgaaaatttattac
aaatatgagggggtatctccttccggcagccacaaaaccaacagtgccgtggcccaggcc
tattacaacaagcaggagggggttaaacggctggccaccgaaaccggcgccggccagtgg
ggttgcgccctctcttttgccgctcacaaattcggcctggactgcaaggtctacatggtt
cgggtttcctatgaccagaaaccctaccgcaaggtaatgatgaacacctacggggccgaa
atcgtggccagccccagccccgatacccccaccggccgcgaagtgctggccaaaaccccg
gacaccccgggctctttggggatcgccatcagtgaggccctggaggacacggtgagccgg
gacgacaccaagtacgccctggggtcggtcttaaaccatgtctgcctgcaccagacggtg
atcggcctggaggccaagcagcaactggccctggtgggggattatcccgatgtggtgatc
ggctgttgcggcggcgggtccaacttcgccggcctggccgccccgtttgtacccgataag
ctggaaggaaaaaatatccgcctgctgggggttgagccggcctcctgcccaaccctgacc
aaggggagttttgcctatgattttggcgatctttcccagcgtacgccgcttttgtacatg
tacaccctggggcatgatttcatcccccccgggattcacgccggcggtctgcgctaccat
ggcatggccccggtgatcagcgccctgatgcgggaaaaactgatggaagccaccgccttg
cagcagttggagtgctttgaggccggcaccctgtttgcccgcactgaaggcattatcccg
gccccggaatcctgccatgcggtccgggcggcgatcattgaagccacgcgggagccggat
aagccccagaccattctcttcaacctctccggccacggcctgctggatctggccagctac
gaaaaatacttcgccggtgaactggtcaactacgaaatgcccgacgaggccattgccgag
gccaccaaaaaccttcccaaactgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system