KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1058Help
Entry
DaAHT2_1058       CDS       T01244                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DaAHT2_1058
Enzymes [BR:dak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DaAHT2_1058
Exosome [BR:dak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DaAHT2_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1265906..1268110
Genome map
AA seq 734 aa AA seqDB search
MTHPLSSDFERIINSDHHDPFQVLGFHLQDGELPAAVVRCFQPAASQVFLLIQGERREMY
KVRDEGIFEFSLPGCREFFPYRLEAHYPDGASHQFEDPYRFWPQLSDFDRYLLNNGTHYQ
LYDKLGAHPVTIDGINGTIFRVWAPNARRISVLGNFNFWDGRLHQMRVLGGSGIWELFIP
EVGAGEPYKFEIRTQQGDILEKADPCQFFSEIRPKSASVVWDTGNFQWSDDEWLAKRRES
SSYRQPLSIYEMHLGSWRRDPADPSRFLSYREIADVLIPYLLEMGFTHVEFLPVAEHPLD
ESWGYQVIGFYAVTSRFGTPDDFAYLVNECHRHGIGVILDWVPSHFPTDGHGLSRFDGTC
LYEHEDPRKGAHQEWGTLVFNYSRAEVANFMIANALFWLERYHIDGLRVDAVASMLYLDY
GRQEGEWLPNEYGGRENIEAIEFLKHLNSIVYDRHPDIMMIAEESTSYFGVSKPTDCGGL
GFGYKWNMGWMNDTLSFFQYDSLFRKYHHSALTFSLLYAFSENFILPLSHDEVVHGKRSL
LNKMPGDNWQKFANLRLLLFFLWTHPGKKLLFMGGEFGQLSEWYCKVSLDWHLLEEGEKH
RQLQHFVRDLNHFYRRNPALWDDDFSPAGFQWLDFNDVDNSIISFARFTENREKFVICLL
NFTPQVHYNYKLGVPRGGRYREVFNSDLAAAGGSGVSNPEPLESINEPCGQAPEHLLVKV
PPLGGVIFKLEEDP
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcccttgtcttccgatttcgagcggatcatcaactccgaccaccacgacccc
tttcaagtcctgggctttcacctgcaagacggcgagctgcccgcagcggtggtgcgctgc
tttcaacccgccgccagccaggtttttctgctgatccagggagaacgccgggagatgtac
aaggtccgcgatgaaggcatttttgaattcagcctgcccggctgccgggaatttttcccc
taccggctggaggcccactaccccgacggtgccagccaccagttcgaggatccttaccgt
ttctggccgcagttgagcgacttcgaccgttatctgctcaacaacggcacccactaccag
ctttacgacaagctgggggcgcacccggtcaccatcgacggcatcaacggcaccattttc
cgtgtctgggcccccaacgcccgccgaatcagcgtgctgggcaatttcaacttctgggac
ggccgcctgcaccaaatgcgggtgctgggcggttcggggatctgggagctttttatcccg
gaagtcggggccggcgagccttacaagtttgaaattcgcacccagcagggcgacatcctg
gaaaaagccgatccttgccagtttttcagcgagattcgccccaagagtgcgtcggtggta
tgggacaccggcaatttccagtggagcgacgatgaatggctggccaagcgccgggaaagc
tccagctaccgccagcccctgtccatttacgagatgcacctgggctcctggcgccgggac
ccggcggacccttcccgctttctctcctaccgggaaatcgccgatgtcctgatcccttat
ctgctggagatgggctttacccacgtggagtttctaccggtggccgagcatcccctggat
gaatcctggggctaccaggtaatcggcttttacgcggtgaccagccgtttcggcactccg
gacgatttcgcctacctggtcaacgaatgtcaccgccacgggatcggggtgatcctggac
tgggtaccctcccacttccccaccgacggtcacgggttgagccgctttgacggcacctgc
ctctacgaacatgaagacccccgcaaaggagcccaccaggaatggggcaccctggtgttc
aactacagccgggccgaggtggccaatttcatgatcgccaacgccctgttctggcttgaa
cgttaccacatcgacggcctgcgggtggatgcggtggcctccatgctttacctggattac
ggccgccaggagggagaatggctgcccaacgaatatggcggccgggaaaacatcgaggcc
atcgaattcctcaagcacctcaacagcatcgtttacgaccggcacccggatattatgatg
atcgccgaggagtccaccagctatttcggggtttccaagcccaccgactgtggcgggctg
gggtttggctacaagtggaacatgggctggatgaacgacaccttgagtttcttccagtat
gactccctgtttcgcaaataccaccatagcgccctgaccttttccctgctctatgccttc
agtgaaaattttatcctgccgttgtctcacgacgaggtggtccacggcaagcgctccctg
ctcaacaagatgcccggcgacaactggcagaaatttgccaacctgcgcctgctgctcttt
ttcctctggacccatcccggcaagaaactactgttcatgggcggtgagtttggtcaactg
tccgagtggtactgcaaggtcagcctggactggcacctgttggaggaaggggaaaaacac
cgtcagttacagcattttgtccgggacttgaaccatttttaccgccgcaacccggccctg
tgggacgacgacttctcgccggcgggttttcagtggctggatttcaacgatgtcgacaat
tccatcatcagttttgcccgtttcaccgaaaaccgggaaaaatttgtgatctgcctgctg
aacttcaccccccaggtgcattataattacaagcttggcgttccccggggcggccggtac
cgggaggttttcaactcggacctggccgcagcgggcggcagcggggtaagcaacccggaa
ccgctggagagtatcaacgaaccctgcggccaggcccctgaacatctgctggttaaagtg
ccgccgctgggaggcgtcatctttaaactggaggaagacccatga

DBGET integrated database retrieval system