KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1065Help
Entry
DaAHT2_1065       CDS       T01244                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DaAHT2_1065
Enzymes [BR:dak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DaAHT2_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1273217..1274776)
Genome map
AA seq 519 aa AA seqDB search
MTDFHRGSGVLLHITSLPGPYGIGELGPQAHAFVDFLAAAGQSYWQFLPLCPTSPGLDNS
PYMGLSAFAGNNLLISLEGLREEGLLGDESLRSAPEFSEYLVDFAQVRAFKEQVLAEAFA
LFERQSQESELAGQLAEFKAGHPWLADYALFISIHEEQQGLPWYDWPEPLARREPAALAE
QRRRLAARIDYHEFVQFIFYRQWQQLHAHAAARGISLIGDLPIYVALDSAEVWAWPECFL
LDPKTHRPTHVAGVPPDYFSATGQRWGNPLFRWHGGGATVQKSLHRWWQRRFAHQFAQAD
IVRIDHFRGFEAFWQVPAEEPDAVRGQWVAGPGREFFRKMEISLGKLPIIAEDLGLITPE
VEELRDRLGFPGMKVLQFAFDSDETNAYLPHNYAGPNCVVYTGTHDNDTSLGWYLSDQVS
ETAKERFLRYANSRDGRPVHRDFIRLALSSVGAVVIIPLQDVLGFGSDCRMNVPGTAEGN
WRWRVASRFLTAEVAAELREETGFYNRLPPPLNDQEKSN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttgacggatttccaccgtggaagtggtgttctgctgcacataacctccctgccgggccct
tacgggatcggcgaactgggcccccaggcccatgcctttgtggactttctggccgccgcc
gggcagagctactggcagtttctgccgctgtgtcccaccagccccggcctggataattcg
ccgtacatggggctttccgcctttgccggtaacaacttgctgatcagccttgaagggctg
cgggaagagggcctgcttggcgatgagtcgctgcgctcggccccggagttttccgagtac
ctggtggattttgctcaagtgcgcgccttcaaggagcaggtgctggccgaggcttttgcc
ctctttgagcggcagtcgcaggaaagtgagttggccgggcaactggctgaatttaaggcc
ggtcatccctggctggcggattacgctctgttcatcagtatccacgaagagcaacagggc
ctgccctggtatgactggcccgagcctctggcgcgacgggaaccggcggccctggcggaa
cagcggcggcggttggcggcccgaatcgactatcacgaattcgtccagtttatcttttac
cgccagtggcaacaactgcacgcccatgcggcggcccgcgggattagtttgatcggtgac
ctgcccatctacgtggccctggacagtgccgaggtgtgggcctggccggaatgtttcctg
ctggaccccaaaacccaccggcccacccatgtggccggggtgccgccggattatttcagt
gccaccggccagcgctggggcaatccgctatttcgctggcacggaggaggggcgacggtg
caaaagagcctgcatcgatggtggcagaggcgattcgcccaccagttcgcgcaggccgat
attgtccggattgaccattttcggggttttgaggccttctggcaggttcccgccgaggag
cccgacgcggttcggggccagtgggtggccggcccggggcgggagttttttcgtaaaatg
gaaataagcctgggcaagttgccgattatcgccgaggatctggggctgatcaccccggag
gtggaggagttgcgtgaccggctggggtttcccgggatgaaggtgctgcagtttgccttc
gattccgatgaaaccaacgcctacctgccccataactacgccggtcccaactgtgtggtc
tataccggcacccacgacaacgacacctccctgggctggtatctgagcgaccaggtcagc
gagacggccaaagagcgctttttgcgctatgccaacagccgggacggtcggccggtgcac
cgggattttatccgcctggccctctcttcggtgggtgcggtggtgattattcccctccag
gatgtgctgggtttcggcagtgactgccggatgaacgttcccggtaccgccgagggcaac
tggcgctggcgggtggcgagccgttttcttaccgccgaggtggcggctgagctgcgggag
gagaccggcttttacaaccggctaccgccgccattaaacgaccaggaaaaaagtaactga

DBGET integrated database retrieval system