KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1156Help
Entry
DaAHT2_1156       CDS       T01244                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DaAHT2_1156
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DaAHT2_1156
Enzymes [BR:dak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DaAHT2_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1369302..1370456)
Genome map
AA seq 384 aa AA seqDB search
MSRQEDNRAALQTRRCHLDKARRVVVKVGSAVLTTGEGLNYEVLDNLAAQIEQLRRDGRE
VILVSSGAVAAGRRKLDLGNRVLSLREKQAAAAVGQSSLMRAYEKIFEQLGTKVAQVLLT
HDAFSRRDRYLNARNTIFTLLQWHLVPVINENDTVSVEELRFGDNDTLGAMVTNLLEADL
FVCLTDVDALYNADPGCHADARPLRTVPAITSEIEEMAGSVGSAVGTGGMLSKIKAARMV
VSRGGAAVIGPGREPDVLLRLFAGEELGSFFLPAPQKIPSRKHWIAYTLRPKGYLVLDEG
ACRAILGGGKSLLPSGVVEVRGDFGLGDPVHCLDRSGKPVAAGLVSYDAAAIKRIMGVKT
SAIVDILGYKDSDEVIHRDNLVIL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcaggaggacaacagagccgctctccaaacccgccgctgccacctggacaag
gcccggcgggtggtggtcaaggttggctcggcggtgttgaccaccggggaagggctcaac
tatgaggtcctggacaacctggccgcccagatcgagcagttgcgccgcgacggccgggag
gtcattctggtcagctccggggcggtggccgccggtcggcgcaagctggacctgggcaac
cgcgttttgagcctgcgcgagaaacaggccgccgccgccgtggggcaaagcagcttgatg
cgggcgtacgaaaaaatctttgaacaactggggaccaaggttgcccaggtgctgcttacc
catgacgccttttcccgccgcgatcgctatctcaatgcccgcaacaccatctttaccttg
ttgcagtggcacctggtgccggtgatcaacgaaaacgacaccgtgtcggtggaggagttg
cgctttggcgacaacgacaccctgggggccatggtgaccaatctgctggaggccgatctc
ttcgtctgcctcaccgacgtggatgccctgtacaacgccgaccccggctgccatgccgac
gcccgtccgctgcggacggtgccggccattacctcggaaatcgaagaaatggccggcagt
gtcggcagtgccgtgggtaccggtgggatgctgagtaagatcaaggcggcccggatggtg
gtctcccgtggcggggcggcggtcatcgggcccggccgggagcccgatgtcctgttgcgg
ctttttgccggtgaggaactgggcagcttttttctgcccgccccgcagaaaatcccctcc
cgcaagcactggattgcttataccttgcggcccaagggttatctggttttagatgaaggg
gcctgccgggccattctggggggcggcaaaagcctgctgccctcgggggttgtcgaggtg
cggggggattttggcctgggcgacccggtgcattgcctggatcgatccggcaaacccgtg
gccgccggactggtttcctatgatgccgccgcgatcaagcgcattatgggggtgaaaacc
tcggccattgtcgatattcttggctacaaggacagcgatgaggtgattcatcgcgacaac
ctggtgatcttgtaa

DBGET integrated database retrieval system