KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1265Help
Entry
DaAHT2_1265       CDS       T01244                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DaAHT2_1265
   01230 Biosynthesis of amino acids
    DaAHT2_1265
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DaAHT2_1265
   00030 Pentose phosphate pathway
    DaAHT2_1265
   00051 Fructose and mannose metabolism
    DaAHT2_1265
   00052 Galactose metabolism
    DaAHT2_1265
  Energy metabolism
   00680 Methane metabolism
    DaAHT2_1265
Enzymes [BR:dak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DaAHT2_1265
Protein phosphatases and associated proteins [BR:dak01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DaAHT2_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1489787..1490884
Genome map
AA seq 365 aa AA seqDB search
MKKIVISTGGGDAPGLNAVIYAVTKSAYQRGWEIYGSKSGYRGLLDPDELIRLTPEKVED
IMPLGGTILGSTNKGNPFAMPVENLAGEIQTLDLSDRIMRNFRRLGFFCHIAVGGDGSLE
IAHRFAQEKGMPVIGVPKTIDNDLEATQRTFGFDTAVSTATEALDKLHSTAKSHDRVMVV
EVMGRDSGWIALNAGISGGADVILIPEIPFDIELVCQKINDNELRDKHYAIVVVAEGAKA
RGMKKAVCKKNCELGRDGELLGGIGEWVAEHIRKLTGKDTRSLTLGHLQRGGSPTTFDRL
LALRFGGAAVRMAELELFDHMVALKTPDMAAVPLAEAVKGRKKVEVNSDKLLTAREIGIC
FGDNN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttatttccaccggcggcggtgacgccccggggctcaacgcggtgatt
tacgcggtaaccaagtcggcatatcagcggggatgggagatatacggcagtaagagcggc
taccggggcctgctggaccccgatgaactaattcgccttacccctgaaaaggtggaagat
atcatgccactggggggaaccatcctgggctccaccaacaagggcaacccctttgccatg
ccggtggaaaatttggccggcgagatccagaccctggacctgtccgaccggattatgcgc
aacttccggcggttgggttttttctgccatatcgcggtgggcggcgacggcagtctggaa
atcgcccaccgctttgcccaagaaaaagggatgccggtgatcggggtgcccaagaccatc
gacaacgacctggaggcaacccaacgcaccttcggctttgataccgccgtctccaccgcc
accgaggccttggacaaactccattccaccgccaaatcccacgaccgggtgatggtggtg
gaggtgatgggccgggattccggctggattgccttgaacgccggcatttccggcggggcc
gacgttatcctgatccctgaaatcccctttgacatcgagctggtctgccaaaaaatcaac
gataacgaactacgggacaaacattacgccattgtggtggtggccgaaggggccaaggct
cgggggatgaaaaaagcggtgtgcaaaaaaaactgtgagttgggccgggacggggaactg
ctgggaggaataggggaatgggtggcggaacatatccgcaagctcaccggtaaagacacc
cgctcgctgaccctggggcacctgcagcgggggggctctcccaccaccttcgatcgcctg
ctggccctgcgtttcggcggggcggcggtgcgcatggccgaacttgaactttttgaccac
atggtggccctgaaaaccccggacatggcggcagtacccctggccgaagcggtaaagggc
cgcaaaaaggtggaagtcaacagcgacaaactgctcaccgcccgggaaatcggcatctgt
ttcggggataacaactga

DBGET integrated database retrieval system