KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1265Help
Entry
DaAHT2_1265       CDS       T01244                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dak01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dak01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dak00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dak00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dak00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dak00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dak00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1489787..1490884
Genome map
AA seq 365 aa AA seqDB search
MKKIVISTGGGDAPGLNAVIYAVTKSAYQRGWEIYGSKSGYRGLLDPDELIRLTPEKVED
IMPLGGTILGSTNKGNPFAMPVENLAGEIQTLDLSDRIMRNFRRLGFFCHIAVGGDGSLE
IAHRFAQEKGMPVIGVPKTIDNDLEATQRTFGFDTAVSTATEALDKLHSTAKSHDRVMVV
EVMGRDSGWIALNAGISGGADVILIPEIPFDIELVCQKINDNELRDKHYAIVVVAEGAKA
RGMKKAVCKKNCELGRDGELLGGIGEWVAEHIRKLTGKDTRSLTLGHLQRGGSPTTFDRL
LALRFGGAAVRMAELELFDHMVALKTPDMAAVPLAEAVKGRKKVEVNSDKLLTAREIGIC
FGDNN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttatttccaccggcggcggtgacgccccggggctcaacgcggtgatt
tacgcggtaaccaagtcggcatatcagcggggatgggagatatacggcagtaagagcggc
taccggggcctgctggaccccgatgaactaattcgccttacccctgaaaaggtggaagat
atcatgccactggggggaaccatcctgggctccaccaacaagggcaacccctttgccatg
ccggtggaaaatttggccggcgagatccagaccctggacctgtccgaccggattatgcgc
aacttccggcggttgggttttttctgccatatcgcggtgggcggcgacggcagtctggaa
atcgcccaccgctttgcccaagaaaaagggatgccggtgatcggggtgcccaagaccatc
gacaacgacctggaggcaacccaacgcaccttcggctttgataccgccgtctccaccgcc
accgaggccttggacaaactccattccaccgccaaatcccacgaccgggtgatggtggtg
gaggtgatgggccgggattccggctggattgccttgaacgccggcatttccggcggggcc
gacgttatcctgatccctgaaatcccctttgacatcgagctggtctgccaaaaaatcaac
gataacgaactacgggacaaacattacgccattgtggtggtggccgaaggggccaaggct
cgggggatgaaaaaagcggtgtgcaaaaaaaactgtgagttgggccgggacggggaactg
ctgggaggaataggggaatgggtggcggaacatatccgcaagctcaccggtaaagacacc
cgctcgctgaccctggggcacctgcagcgggggggctctcccaccaccttcgatcgcctg
ctggccctgcgtttcggcggggcggcggtgcgcatggccgaacttgaactttttgaccac
atggtggccctgaaaaccccggacatggcggcagtacccctggccgaagcggtaaagggc
cgcaaaaaggtggaagtcaacagcgacaaactgctcaccgcccgggaaatcggcatctgt
ttcggggataacaactga

DBGET integrated database retrieval system