KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1265Help
Entry
DaAHT2_1265       CDS       T01244                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00010  Glycolysis / Gluconeogenesis
dak00030  Pentose phosphate pathway
dak00051  Fructose and mannose metabolism
dak00052  Galactose metabolism
dak00680  Methane metabolism
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01120  Microbial metabolism in diverse environments
dak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DaAHT2_1265
   00030 Pentose phosphate pathway
    DaAHT2_1265
   00051 Fructose and mannose metabolism
    DaAHT2_1265
   00052 Galactose metabolism
    DaAHT2_1265
  Energy metabolism
   00680 Methane metabolism
    DaAHT2_1265
Enzymes [BR:dak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DaAHT2_1265
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     DaAHT2_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADH85961
JGI: DaAHT2_1265
UniProt: D6Z336
Position
1489787..1490884
Genome map
AA seq 365 aa AA seqDB search
MKKIVISTGGGDAPGLNAVIYAVTKSAYQRGWEIYGSKSGYRGLLDPDELIRLTPEKVED
IMPLGGTILGSTNKGNPFAMPVENLAGEIQTLDLSDRIMRNFRRLGFFCHIAVGGDGSLE
IAHRFAQEKGMPVIGVPKTIDNDLEATQRTFGFDTAVSTATEALDKLHSTAKSHDRVMVV
EVMGRDSGWIALNAGISGGADVILIPEIPFDIELVCQKINDNELRDKHYAIVVVAEGAKA
RGMKKAVCKKNCELGRDGELLGGIGEWVAEHIRKLTGKDTRSLTLGHLQRGGSPTTFDRL
LALRFGGAAVRMAELELFDHMVALKTPDMAAVPLAEAVKGRKKVEVNSDKLLTAREIGIC
FGDNN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttatttccaccggcggcggtgacgccccggggctcaacgcggtgatt
tacgcggtaaccaagtcggcatatcagcggggatgggagatatacggcagtaagagcggc
taccggggcctgctggaccccgatgaactaattcgccttacccctgaaaaggtggaagat
atcatgccactggggggaaccatcctgggctccaccaacaagggcaacccctttgccatg
ccggtggaaaatttggccggcgagatccagaccctggacctgtccgaccggattatgcgc
aacttccggcggttgggttttttctgccatatcgcggtgggcggcgacggcagtctggaa
atcgcccaccgctttgcccaagaaaaagggatgccggtgatcggggtgcccaagaccatc
gacaacgacctggaggcaacccaacgcaccttcggctttgataccgccgtctccaccgcc
accgaggccttggacaaactccattccaccgccaaatcccacgaccgggtgatggtggtg
gaggtgatgggccgggattccggctggattgccttgaacgccggcatttccggcggggcc
gacgttatcctgatccctgaaatcccctttgacatcgagctggtctgccaaaaaatcaac
gataacgaactacgggacaaacattacgccattgtggtggtggccgaaggggccaaggct
cgggggatgaaaaaagcggtgtgcaaaaaaaactgtgagttgggccgggacggggaactg
ctgggaggaataggggaatgggtggcggaacatatccgcaagctcaccggtaaagacacc
cgctcgctgaccctggggcacctgcagcgggggggctctcccaccaccttcgatcgcctg
ctggccctgcgtttcggcggggcggcggtgcgcatggccgaacttgaactttttgaccac
atggtggccctgaaaaccccggacatggcggcagtacccctggccgaagcggtaaagggc
cgcaaaaaggtggaagtcaacagcgacaaactgctcaccgcccgggaaatcggcatctgt
ttcggggataacaactga

DBGET integrated database retrieval system