KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1366Help
Entry
DaAHT2_1366       CDS       T01244                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DaAHT2_1366
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DaAHT2_1366
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DaAHT2_1366
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DaAHT2_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1614018..1614782
Genome map
AA seq 254 aa AA seqDB search
MSLTQQIRQAKADREILLMTHLVLGYPSFAVNREVIARMVAAGVEIIELQIPFSEPVADG
PVILRANQEAIDRGVRVRQCLEFAAEMTAEHQIPFLFMTYYNILFKYGVEDFLAQARKVG
VRGLIIPDLPPEEGEEYLAACRKHELAPIQIFAPTSSDERMAKLAGHGDGFIYCVARRGV
TGAQTSFDREFDDYIARCRRATDLPLAVGFGISNRADVEMLKGKAEIAVIGSATIRLVEE
HGPAAVTEFMEGLR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcactcagcaaatcagacaagccaaagcggaccgggaaatcctgctgatgacc
cacctggtgctgggttacccctcctttgcggtcaaccgcgaggtgatcgcccgaatggtg
gcggcgggggtggagatcatcgagctgcagatccccttttccgagccggtggccgacggg
ccggtaattctccgggccaaccaagaggccatcgaccgcggcgtcagggtacggcaatgc
ctggagtttgccgccgaaatgaccgccgaacaccaaatccccttcctcttcatgacctac
tacaatattttgttcaagtacggggtggaagactttctggcccaggccaggaaggtgggc
gtgcgggggctgatcatccccgatctgccccccgaggagggagaagagtacctggcggcc
tgccgcaagcatgagctggccccgatccagatcttcgcccccacaagcagtgatgagcgc
atggccaagctggccggtcacggggatgggttcatctactgcgtggcccggcggggggtc
accggcgcccagaccagcttcgaccgggagttcgacgattacatcgcccgctgccgccgg
gccaccgacctgcctttggcggtgggatttggcatcagcaaccgggccgacgtggagatg
ctgaaaggcaaggcggagatcgcggtgatcggctcggccaccatccgcctggtggaagaa
cacggcccggcggcggtgaccgaatttatggaggggttgcgctaa

DBGET integrated database retrieval system