KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1519Help
Entry
DaAHT2_1519       CDS       T01244                                 

Definition
Phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DaAHT2_1519
Enzymes [BR:dak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     DaAHT2_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1776883..1777554)
Genome map
AA seq 223 aa AA seqDB search
MVTTLCLVRHGETEGSDIPRYKGSLDVPLSATGLEQVRHTAQRLRRALAELLRQRRQSYL
RVVHDEEEAATTEGLEVVYCSPLIRAVKSAELIAAPHGLTPVVEPELRERHFGVWEGLSF
AEIKRDFPEAFTAWAADPVRFAPPEGESTLEVAQRGQAALEAILARHPGGNIGVVAHGGV
NRVILCRLLGMPLENIFRLEQDLACYNIIELWEQLPVIKALNA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggttacgactctctgtctggtaaggcacggggaaaccgaaggttcggatattccccgt
tataaaggaagtttggatgtgcccctgtcggccactggtctggagcaggtgcggcacacc
gcccagcgcctgcgccgggcgctggcggagttgctccggcagcggcggcaaagttatctg
cgggtggtccatgatgaagaggaagcggccaccacggaagggctggaggtggtttactgc
tccccgctgatccgggcagtgaagagcgccgagctgattgccgccccccacggcttgacc
ccggtggtggagccggagttgcgggagcgccatttcggggtctgggagggcctgagcttt
gccgagatcaagcgcgatttccccgaggcctttaccgcctgggcggccgatccggtacgt
tttgcgcctcccgagggggaaagcaccctggaggtggcgcagcgggggcaggccgccctg
gaagccatactggcccggcatcccggtggcaacatcggggtggtggcccacggcggggtt
aatcgggtgattttgtgccggctgctggggatgccgctggaaaacatcttccgcctggag
caggatctggcctgctacaacatcattgaactgtgggagcagttgccggtgattaaagcc
cttaacgcctga

DBGET integrated database retrieval system