KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1602Help
Entry
DaAHT2_1602       CDS       T01244                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dak03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1880992..1881909
Genome map
AA seq 305 aa AA seqDB search
MPELPEVEVVRRGLEPLVLQRQIARISASGLPLRRPVPLAELRRWGEGARVTGVSRRAKY
LLLHLDNSALLIFHLGMTGKFYPAVADDPPRKHDHLVLHLNDHANDGHGGRGASGQKVAQ
IRFNDCRRFGLVAVCAPAETTAPALLAGLGPEPLDDKAFTPAYLAQRCAHRRTPIKNLLM
DNRVVVGIGNIYANEVLFAAGVHPQTPAGEISRARLKKICAAAREILTRAIAAGGTTIAD
FANAAGESGYFQVQLAVYGRGGQPCPRCGREIVRQVQAGRATYFCPRCQRPPKVISKNKE
QKSGK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactaccggaagtggaagtggtgcgccgggggctggaacccttggtgctgcag
cggcaaatcgcccgcatcagcgccagcggcctgcccctgcgccggcccgtgcccctggcc
gagctgcggcgctggggggaaggcgcccgggtaaccggggtgagccggcgggccaagtac
ctgctgctgcacctggacaactccgccctgctgatctttcacctgggcatgaccggcaag
ttctacccggccgtcgccgacgacccaccccgcaaacatgaccacctggtactgcacctg
aatgatcatgcaaacgacgggcacgggggccggggggcaagtggccaaaaggtggcccag
atacgtttcaacgattgccgccgcttcgggctggtcgccgtctgtgcccctgccgagacc
acagcgccagcgctgctggccgggctggggcccgaacccctggatgacaaggccttcacc
cccgcctacctggctcaacgctgcgcccaccggcgcacccccatcaaaaatctgctgatg
gacaatcgggtggtggtggggatcggcaatatctacgccaatgaagtgctgtttgccgcc
ggggtacacccgcaaaccccggccggggaaatatcccgggccaggttaaaaaaaatctgc
gccgccgcccgggaaatcctgacccgggccattgccgccggtggcaccaccattgccgat
tttgccaacgctgccggggagagcggttattttcaggtgcaactggccgtttacgggcgc
ggcggccaaccctgcccgcgctgcggccgggaaatagtccggcaggtgcaggccgggcgg
gcaacctacttttgcccccgctgccaacggccgcccaaagtaatatcaaaaaacaaggaa
caaaagagcggcaaataa

DBGET integrated database retrieval system