KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1680Help
Entry
DaAHT2_1680       CDS       T01244                                 

Definition
response regulator receiver modulated chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DaAHT2_1680
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DaAHT2_1680
Enzymes [BR:dak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DaAHT2_1680
Two-component system [BR:dak02022]
 CheA family
  CheA-CheYBV
   DaAHT2_1680
Bacterial motility proteins [BR:dak02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DaAHT2_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1967312..1968349)
Genome map
AA seq 345 aa AA seqDB search
MRKIRVLVVDDSAVVRKVFTEELSREKDIEVVATAPDPYVARDKIVELKPDVITLDIEMP
RMDGITFLRKLMRYLPLPVIIVSSLTREGGSLALEAMEIGAVEVISKPGEAYSVGDMSAQ
LAEKIRAAAQVDVSQRRRVITQPRSVAPKLSLTRTTNKLIAIGASTGGTEALKEVLTQFP
PNSPGIMIVQHMPAKFTTSFAERLDSLCQIRVKEAEDGDAVVPGTALLAPGNYHMVMRRS
GARYYVNIKSGPMVCYQRPAVDVLFNSVAAYGGANAIGVILTGMGKDGAQGMLKMKEAGA
RTIAQDEASSVVFGMPKEAIELGCVDKILPLKDIPAQVLKFLENE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagattagagtgctggtggtggatgattccgccgtggtgcgcaaagtttttacc
gaggaactgtcgcgcgaaaaagatatcgaggtggtggccaccgctcccgacccttacgtg
gccagggacaagatcgtcgaacttaagcccgacgtgatcaccctggacatcgaaatgccg
cggatggacgggatcaccttcttgcgcaaactgatgcgttatctgccactgccggtgatc
atcgtcagttcgctgaccagggagggcggtagcctggccctggaggccatggaaatcggg
gcggtggaggtaatcagcaagccgggcgaggcctattcggtgggcgacatgagcgcccag
ttggccgagaaaattcgggccgccgcccaggttgacgtcagccagcggcgccgggtgatt
acccagccccgcagtgtggcccccaagctttccctcacccgcaccaccaataagcttatt
gccattggcgcctccaccggtggtaccgaagcgctcaaagaggtcctgacccagtttccc
cccaactccccaggtatcatgattgttcagcatatgccggccaaatttaccaccagcttt
gccgaacggttggacagcctctgccagatcagggtcaaggaggccgaagacggtgatgcg
gtggtgcctggtaccgccctgctcgccccgggtaactaccatatggtgatgcgccgcagc
ggggcccgctattatgtcaacatcaagagcggccccatggtctgttatcagcgcccggcg
gtggatgtcctgttcaactcggtggcggcctacggcggggccaacgccatcggggtgatc
cttaccggcatgggcaaggacggcgcccaagggatgctgaaaatgaaggaggcgggcgcc
cggaccattgcccaggatgaggccagcagcgtggtcttcgggatgcccaaggaggccatc
gagctgggttgcgtcgacaagatcctgcccttgaaggatatcccggcccaggtcctcaag
tttcttgaaaacgagtag

DBGET integrated database retrieval system