KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1868Help
Entry
DaAHT2_1868       CDS       T01244                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dak  Desulfurivibrio alkaliphilus
Brite
Enzymes [BR:dak01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     DaAHT2_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2165422..2166483
Genome map
AA seq 353 aa AA seqDB search
MPITPLNFFSGCRLITASAAGLLLFFGLAWLAGYGPSTSPFAVAAQADSGPVGDVAESQL
ITREPIQPIPRQIAYDREKAELGRRLFNETMLSLDHSISCASCHDLNGGGHDPRPASIGI
HSRQGTMASPTVFNAVFNFRQFWNGRAADLREQAAGPLTDPLEMGMSEQEVERRLNEDPG
YREAFSKIYGGRQVRFEQVLDALAEFQRALITPDSLFDLYLRGEAVLMPQQQQGYLEFKE
LGCVTCHNGVNVGGNSFQKMGVIFPRETDDERKIMDLNQVSGREEDRQVFKVPTLRNITL
TAPYFHDGSAADLPEALQNMAHHNLGVELSSRQIYLLVAFLETLTGQRPTILK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcctattacacctcttaattttttttccggctgtcggctgatcacggccagcgcggcc
gggctgctgctgtttttcgggttggcctggctggctggctatggcccctctacgtcgccc
tttgccgttgccgcccaggccgactccgggccggtgggggatgttgccgaaagccaactg
atcacccgcgagcctatccagcccataccccggcagatcgcttacgaccgggaaaaggcc
gaactgggtcggcggctgttcaacgagaccatgctgtcgctggaccactcgatttcctgc
gcctcctgccacgatctcaacggcggcggccacgacccccggccggcgtccatcggcatt
cacagccggcaaggcaccatggcctctcccaccgtctttaacgcggtgttcaattttcgc
cagttctggaacggccgggccgccgacctgcgggaacaggcggccgggccgctaacggac
ccgctggaaatggggatgagcgagcaggaggtggaacggcggctcaatgaagaccccggc
taccgtgaggccttcagcaaaatatacggcggccggcaggtgcgtttcgagcaagtgctg
gatgccctggccgagttccagcgggccctgatcaccccggacagccttttcgatctgtac
ctgcgcggcgaggcggtgcttatgccccaacagcagcaggggtacctggaattcaaggag
ctgggttgtgttacctgccacaacggggtcaatgtcggcggcaattcatttcagaagatg
ggggtgatctttccccgtgaaaccgatgatgaacgcaagatcatggatcttaaccaggtc
tccggccgggaagaggaccgccaggtcttcaaggtgcccaccctgcgcaatatcaccctt
accgccccctacttccacgacggctccgccgccgatctgccggaggccctgcagaacatg
gctcaccacaacctgggggtggagcttagcagccgacagatctaccttctggtggctttt
ctggaaaccctgaccggccaaaggccgaccattcttaagtga

DBGET integrated database retrieval system