KEGG   Desulfurivibrio alkaliphilus: DaAHT2_2367Help
Entry
DaAHT2_2367       CDS       T01244                                 

Definition
glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DaAHT2_2367
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    DaAHT2_2367
Enzymes [BR:dak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DaAHT2_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2755158..2756153
Genome map
AA seq 331 aa AA seqDB search
MNEATLPHPGGLFMVGLPGLALDDSTRELIVRERINDFILFKRNVESPAQLGRLTAALAD
ACRTTGLGPPLISIDQEGGTVARLEPPFTVFPDARQLAAEPDPEAALTAYAETCAQELRS
VGINMNMAPVLDLCPAGQGYYMERRVLGDDPAEVARLGQLIIEKMQHNGLIACGKHFPGL
GAARLDPHREISAIERSRQELEQDLLPFRAAVEAGVAALMTSHTVYPALDPQRPATLSPL
ILADLLRRKLGYTGVVVTDDLEMGAIERQRGVPEAALAAFQAGADQLLICRDHDKVRRAL
ARFKQALAGGEIAPARLRQSLARIAALRLLA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagccacgctgccccatcccggggggttgttcatggtcggcctgcccggcctg
gcgcttgatgattccacccgtgaactgatcgtgcgcgaacggattaacgactttatcctg
ttcaagcgcaacgtggaaagccccgctcagcttggccgcctcaccgccgccctggctgac
gcctgccgcaccaccggcctggggccgccactgatcagcatcgaccaggagggcggcacg
gtggcccgcctggagccgcctttcaccgtttttcccgatgcccggcagttggctgcggaa
ccggacccggaggccgccttaaccgcctacgccgaaacctgtgcccaagagctgcgctcg
gtggggatcaatatgaacatggccccggtgcttgatctctgccccgccggtcagggctat
tatatggaaaggcgggtgctgggcgacgacccggccgaggtggcccgcctcggccaattg
atcatcgaaaagatgcagcataacggcctgattgcctgcggcaagcacttccccggcctg
ggggcggcccggctggacccgcaccgggaaatttcggccatcgagcgcagtcggcaagag
ctggagcaagatctgctcccctttcgggccgccgtcgaggccggggtggcggcgctgatg
acctcccataccgtctatcctgccctggacccgcagcgtcccgccaccctgtcgccgttg
atcctggccgacctgctgcgccgtaagttgggctataccggggtggtggttaccgatgac
ctggagatgggggccattgaacggcagcgaggggtgcctgaggcggccctggccgccttt
caggccggggccgaccaactgctgatctgccgggatcatgacaaggtaagaagggccctg
gcccgctttaaacaggccctggccgggggtgagatagccccggccaggctccggcagtcc
ctggcccggatcgccgccctgcgcttacttgcttga

DBGET integrated database retrieval system