KEGG   Desulfurivibrio alkaliphilus: DaAHT2_2435Help
Entry
DaAHT2_2435       CDS       T01244                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dak00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DaAHT2_2435
Enzymes [BR:dak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DaAHT2_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2834436..2836904
Genome map
AA seq 822 aa AA seqDB search
MQDELKGIVERVTFHNPENGWSVLRVQPFDQRLEAVPVLVHQQRVFAGATMRFLGQWSEH
PRFGRQFKADTALEVKPASAAALEKYLGSGLIKGVGPKTARKIVRHFGDQTLDIFEQEID
RLTEVPGIAEAKLKSISAAWQEHRAIREVMLFLQGHGISTLFAVRIYKEYGDKAIEVVNA
DPYRLAEDIFGIGFFSADQVALSLGFAKDGEPRLMAAIRHVLAAGREQGHCYLTLAQVIA
GVNELLELDIAPRAEGLLAQMAAAGKLMVRTLADSQGNPQTCYYSKTLYYDEETVATRIK
ALLAPVEVDRQRVADWLARYCQNQKMELSAEQQQAVAGVVGRRFAILTGGPGCGKTTATR
VLVRLLEAMGQRVVLAAPTGRAAQRLGEVVGREARTIHRLLEWQGSGFKRRADHPLEGDF
FIVDECSMLDVSLSAALLRAVPPQGQVLFIGDPDQLPPVGAGNVLRDLLNVAAVPAFRLT
KVFRQAAASAIVRFAHQINRSEVPRIDSPFQHPERWQQECDCLFLDADEATREQLHFLGR
VRRHFAPDHGRFREQADPFSFRLEEAVRPYESEFELPEKFRHVDLEQLLGAESRSEELKA
LLKKVHPWSALHYGLSAVEVVKKLYREWIPKYRGQGSAETGIEIQVLSPMTRGSLGTRNL
NEVLQAEINPAGPGRPEVRLGERLFRLGDRVIHTRNNYDLEVFNGDIGVISAVDHEAQTC
EVTFPPDSRRVNYRRDQLPELELAYAITIHKSQGSEFAAVIIPVLSQHYRMLFNNLIYTG
LTRARRLAVLVGSRRALALAVHNRDTAQRQTALVPLLAADSP
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgaactgaagggtattgtcgagcgggttacctttcataacccggaaaacggc
tggtcggtgctgcgggtgcagccctttgatcagcgcctggaggcggtgccggtgctggtc
caccagcagcgggtctttgccggggccaccatgcgttttctggggcagtggagtgagcac
ccccgttttggccgccagttcaaggccgacaccgccctggaggtgaagccggcttccgcc
gcggcgctggaaaaatatctcggctccggcttaatcaaaggtgtcggccccaagaccgcc
cgcaaaatcgtgcgccatttcggcgaccaaaccctggatatcttcgaacaggagatcgac
cggctcaccgaggtgccgggaattgccgaggccaagctcaaaagcatcagcgccgcctgg
caggagcaccgggccatccgcgaagtaatgctctttttgcagggccatggcatcagcacc
ctgtttgcggtgcggatctacaaggagtatggcgataaggccatcgaggtggtcaatgcc
gatccctaccggctggccgaggatattttcggcatcggctttttttccgccgaccaggtg
gccctgagcctgggctttgccaaagatggcgagccgcgtctgatggccgccatccgccac
gtgctggccgccggccgggagcaggggcactgctacctgaccctggcccaggtgatcgcc
ggggtcaatgaactgctggagctggacatcgccccccgtgccgaaggcttgctggcccag
atggcggcggcgggcaagctgatggtgcgcaccctggccgatagccagggcaatccccaa
acctgttattattccaagaccctttattacgacgaagaaacggtggcgaccaggatcaag
gccctgctggcgccggtggaagtggaccggcagcgggtggccgactggctggcccgttac
tgccaaaaccaaaagatggagctttccgccgagcagcaacaggcggtggccggtgttgtg
ggccgccgttttgccatcctcaccggcgggccgggttgcggcaagaccaccgccacccgg
gtgctggtgcggctgctggaggccatgggtcaaagggtggtgttggccgcccccaccggc
cgggccgcccagcggctgggtgaagtggtgggccgcgaggcccgcaccattcaccggctg
ctggaatggcagggcagcggcttcaagcgccgggccgaccaccccctggagggtgatttt
ttcatcgtcgatgaatgttccatgctggatgtcagccttagcgccgccctgttgcgggcc
gtgccgccccaaggccaggtgctgttcatcggcgaccccgaccagttgccgccggtgggg
gccggcaacgtgctgcgggatctgttgaatgttgcggctgtgcccgctttccggctgacc
aaggtgtttcgccaggcggcggcctcggccattgtccgttttgcccaccagatcaaccgc
agcgaagtaccccggattgattcccccttccagcacccggagcgctggcagcaggagtgc
gactgcctctttctcgatgccgatgaggccacccgggagcagttgcattttttaggccgg
gtgcgccgccatttcgccccggatcatggccgcttccgggagcaggccgaccccttcagc
tttcgcctggaagaggcggtgcggccctatgaaagcgaatttgaattgccggaaaagttt
cgccatgtcgacctggagcagttgctgggggccgaaagccgttccgaggaactcaaggcc
ctgctgaaaaaggtgcacccctggtcggccctgcattacgggctgtcggcggtggaggtg
gtaaagaaactctaccgggaatggattcccaagtaccgggggcagggaagtgcggagacg
ggtattgaaatccaggtactctcgcccatgacccggggcagcctgggcacccgcaacctc
aacgaggtgttgcaggcggagatcaaccccgccgggccggggcggcccgaggtgcggctg
ggggagcggcttttccgcctgggcgaccgggtaatccacacccgcaacaactacgacctg
gaggtgttcaacggcgatatcggggttatcagcgccgtcgatcatgaggcccagacctgc
gaggtcaccttccccccggacagccgccgggtgaattaccgccgcgatcaactgccggag
ctggagctggcctatgccatcaccatccacaagtcccagggcagcgagtttgccgcggtg
atcatcccggtgttgagccagcattaccggatgctgttcaacaacctgatctacaccggc
ctcacccgggcccgccggctggcggtgctggtgggcagccgccgggccctggccctggcg
gtccacaaccgcgacaccgcccaacgccagaccgccctggtaccgttactggccgccgac
tccccgtaa

DBGET integrated database retrieval system