KEGG   Desulfatibacillum alkenivorans: Dalk_0815Help
Entry
Dalk_0815         CDS       T00813                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dal  Desulfatibacillum alkenivorans
Brite
Enzymes [BR:dal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dalk_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1095451..1096179)
Genome map
AA seq 242 aa AA seqDB search
MGPKVLIALALAGGLFWASAVLAGGNAPGPDYQKLREQMVYSQIEKRGVKDAGTLAAMRK
VERRLFVPESYRNQAYNDYPLPIGEGQTISQPYIVALMTQVLELDGSEKVLEIGTGSGYQ
AAVLGELAREVYTMEIVEPLGERAAKILAQLHYDNVKVKVGDGYKGWPEHAPFDAIIVTC
APTDIPAPLVEQLAEGGRMVIPVGEAGNQNLVLLTKINGKVKEKKIIPVRFVPMTRENGS
VY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggacctaaagtgctgattgcactggcgctggccggaggcctgttttgggcgtccgcc
gttttggcgggcgggaacgccccaggccccgattatcaaaagctgcgtgaacagatggtg
tatagtcagattgaaaaacggggagtaaaagatgccgggactctcgccgccatgcgcaag
gtggaacggcgccttttcgtccccgagtcctatcgcaatcaggcgtacaacgactacccc
cttcccataggagaaggccaaaccatatcccagccgtacatcgtggcgctcatgacccag
gttttggaattggacggatcggaaaaggtgctggaaatcgggacaggctcgggatatcag
gctgcggttttgggggaattggcccgggaagtgtacaccatggaaatcgtggagcccctg
ggggaacgagccgcgaaaattctggcccaactgcattacgacaatgtgaaggtgaaagtc
ggggacgggtacaaaggctggcccgaacatgctccgtttgatgctattatcgtcacttgt
gcgcctacggacatccccgcgcctttggtggagcaactggctgaagggggccgcatggtc
atccccgtgggcgaggcgggaaaccaaaatctggtattgctgacgaaaatcaacggcaag
gtcaaagaaaagaagatcatccccgtgcgctttgttcccatgacccgggaaaacgggagc
gtgtattag

DBGET integrated database retrieval system