KEGG   Desulfatibacillum alkenivorans: Dalk_0826Help
Entry
Dalk_0826         CDS       T00813                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00340  Histidine metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Dalk_0826
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dalk_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACL02531
JGI: Dalk0826
UniProt: B8FHW4
Position
1109383..1110684
Genome map
AA seq 433 aa AA seqDB search
MKIYQYPSQAAEKRFKSMVDRGVSFRVKDVKAVSKILEDVRKNGDQAVVDYSNRFDAGGM
TVGSMRVTDQEMKDALAQVDPDFQKAMERSHRNVADFHRRQLPKSWITTDRPGTVLGQMI
RPVDAAGVYVPGGQGGSTPLVSSVIMGGVPAKIAGVERVIMVTPPRADGTVHPYLLAAAH
LTGIDEVYKIGSAWAIAAMAFGTETIKAVDVIVGPGNIYVTIAKSLVAGTVGIDMIAGPS
EVLVIADHTADPDCIAADLLSQAEHDPMASSILVTTKRKIALNAKKALYERVAKLSRREI
AEASVQKNCVAFVVDDLDAAADLSNAIAPEHLELLVEDPFAYFPKIKHAGAMFLGQYTPE
PVGDYVAGPNHVLPTQGTGRFSSALNVDNFLKKTSLLHYSKETFDEEAEDIIRLAEVEGL
TAHAESVKARLKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctaccagtatccttcccaggctgcggaaaaacggtttaagtccatggtggac
cggggcgtctcgttccgggtcaaggacgtgaaagccgtgtccaaaattttggaggacgtg
cggaaaaacggcgaccaagcggtggtggactactccaaccgctttgacgccggcggcatg
accgtgggatccatgcgggtgaccgaccaggaaatgaaagacgccctggctcaggtcgat
cccgattttcaaaaagccatggaacggtcccatcgcaatgtggcggattttcatcgcagg
cagcttcccaaatcctggatcaccacggacaggccgggcacagttttaggccagatgatc
cgccccgtggacgcggcgggcgtatacgtgccgggagggcagggcggcagtacgcccttg
gtttcctcggtcatcatgggcggggttcccgcaaagatcgccggcgtagagcgggtaatc
atggttacccctcccagggccgacggaaccgtacacccctatcttctggcggcggcccat
cttacaggaatcgacgaggtctataaaatcggcagcgcatgggccatcgcagccatggct
ttcggcaccgaaaccatcaaggctgtggacgtcatcgtgggccctggcaatatttacgtg
accatcgccaaaagcctggttgccggaaccgtgggcatcgacatgatcgcaggccccagc
gaggtcctggtcatcgcggaccacacagcagatcccgactgcatcgccgccgatcttctc
tcacaggctgaacacgatcccatggcaagctccatcctggtgaccacaaaaagaaaaatc
gccctgaacgccaaaaaagccctgtacgaacgggtggccaagctctcccgccgggaaata
gccgaagcatcagtgcaaaaaaactgcgtggcctttgtggtggacgacctggacgcggcc
gcggacctgtccaacgccatcgccccggagcacttggaactcctggtggaagaccccttc
gcctacttccccaaaatcaagcacgcgggcgccatgttcctgggccagtacactcccgag
cccgtaggagactacgtggcagggcctaatcacgtgctgcccacccaaggcacaggacgc
ttttcctctgctttaaatgtggacaacttcctcaagaaaaccagcctcctgcactattcc
aaggagacgttcgatgaggaagccgaggacatcatccgcctggccgaggtggaaggcctc
accgcccacgccgagtcagtaaaagcgagactgaaaaagtaa

DBGET integrated database retrieval system