KEGG   Desulfatibacillum alkenivorans: Dalk_0826Help
Entry
Dalk_0826         CDS       T00813                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dalk_0826
  Amino acid metabolism
   00340 Histidine metabolism
    Dalk_0826
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dalk_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1109383..1110684
Genome map
AA seq 433 aa AA seqDB search
MKIYQYPSQAAEKRFKSMVDRGVSFRVKDVKAVSKILEDVRKNGDQAVVDYSNRFDAGGM
TVGSMRVTDQEMKDALAQVDPDFQKAMERSHRNVADFHRRQLPKSWITTDRPGTVLGQMI
RPVDAAGVYVPGGQGGSTPLVSSVIMGGVPAKIAGVERVIMVTPPRADGTVHPYLLAAAH
LTGIDEVYKIGSAWAIAAMAFGTETIKAVDVIVGPGNIYVTIAKSLVAGTVGIDMIAGPS
EVLVIADHTADPDCIAADLLSQAEHDPMASSILVTTKRKIALNAKKALYERVAKLSRREI
AEASVQKNCVAFVVDDLDAAADLSNAIAPEHLELLVEDPFAYFPKIKHAGAMFLGQYTPE
PVGDYVAGPNHVLPTQGTGRFSSALNVDNFLKKTSLLHYSKETFDEEAEDIIRLAEVEGL
TAHAESVKARLKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctaccagtatccttcccaggctgcggaaaaacggtttaagtccatggtggac
cggggcgtctcgttccgggtcaaggacgtgaaagccgtgtccaaaattttggaggacgtg
cggaaaaacggcgaccaagcggtggtggactactccaaccgctttgacgccggcggcatg
accgtgggatccatgcgggtgaccgaccaggaaatgaaagacgccctggctcaggtcgat
cccgattttcaaaaagccatggaacggtcccatcgcaatgtggcggattttcatcgcagg
cagcttcccaaatcctggatcaccacggacaggccgggcacagttttaggccagatgatc
cgccccgtggacgcggcgggcgtatacgtgccgggagggcagggcggcagtacgcccttg
gtttcctcggtcatcatgggcggggttcccgcaaagatcgccggcgtagagcgggtaatc
atggttacccctcccagggccgacggaaccgtacacccctatcttctggcggcggcccat
cttacaggaatcgacgaggtctataaaatcggcagcgcatgggccatcgcagccatggct
ttcggcaccgaaaccatcaaggctgtggacgtcatcgtgggccctggcaatatttacgtg
accatcgccaaaagcctggttgccggaaccgtgggcatcgacatgatcgcaggccccagc
gaggtcctggtcatcgcggaccacacagcagatcccgactgcatcgccgccgatcttctc
tcacaggctgaacacgatcccatggcaagctccatcctggtgaccacaaaaagaaaaatc
gccctgaacgccaaaaaagccctgtacgaacgggtggccaagctctcccgccgggaaata
gccgaagcatcagtgcaaaaaaactgcgtggcctttgtggtggacgacctggacgcggcc
gcggacctgtccaacgccatcgccccggagcacttggaactcctggtggaagaccccttc
gcctacttccccaaaatcaagcacgcgggcgccatgttcctgggccagtacactcccgag
cccgtaggagactacgtggcagggcctaatcacgtgctgcccacccaaggcacaggacgc
ttttcctctgctttaaatgtggacaacttcctcaagaaaaccagcctcctgcactattcc
aaggagacgttcgatgaggaagccgaggacatcatccgcctggccgaggtggaaggcctc
accgcccacgccgagtcagtaaaagcgagactgaaaaagtaa

DBGET integrated database retrieval system