KEGG   Desulfatibacillum alkenivorans: Dalk_0885Help
Entry
Dalk_0885         CDS       T00813                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dalk_0885
Enzymes [BR:dal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Dalk_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1189118..1190983
Genome map
AA seq 621 aa AA seqDB search
MARARRKGRQRFHLLEPDYERPLHKIPEETAQGILEKLTILYGEQEARIYQAEVLRLMKV
YYAHKSPEMIEFERDFDANNRFTEEDVILITYGDLLHDDRMSPLDTLTYFCERHLRGTIN
TLHLLPFFPYSSDRGFAVIDFEEVDPRLGTWEDIDQLKSDFRLMFDGVFNHVSSKSKWFA
EFRDGAPDFQDFFIVFSTSEAISKEHLKIITRPRPTPILSEFSTYSGYKWVWTTFSPDQI
DLNFKNPRVLLKTIQILLYYIRRGSDVLRLDAVTYLWHELGTHCVHLKETHAIIQLFRLI
IDAVAPVAALITETNVPHDQNITYFGDGSNEAHMVYNFALPPMVLHAFQNEDATALTKWA
SSLDQVSKTATYFNFLDSHDGVGVTPVKEILSAKEIELMAWRVIEHGGFISYKDDGDGNL
SPYEMNITWWSAINREDADESDDFQVKRFCASRSIALALRGVPGIYFHGLLGSKNDAEAV
IAEKHTRSINRMVLDYSSLKDGLNNPESTTYKVVNQYGRMIAKRVKETAFHPNAPQDVLD
LHPAIFCVKRTCQEAGQPLLALTNVSGDQIVVEIPCNTTGIHCNRFVEILSGDRRTFETD
KGFNLQLTMEPYDVFWLTPAK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcacgtagaaaaggcaggcagcgcttccacctgttggagccggattatgag
cgccctttgcataaaattcccgaggagacggctcagggaattcttgaaaaattgacgatt
ctgtacggggagcaagaggccaggatttaccaagctgaagtccttcgcctcatgaaggtc
tattatgcgcataaatcccctgaaatgattgaattcgaacgggattttgacgccaataac
cggtttaccgaagaggatgtcatcctcattacatacggggacctgctgcatgacgaccgt
atgtcccccctggacaccctcacctatttctgcgaacgccatttacggggaaccatcaac
accttgcatttgttacctttttttccctactcgtcggatcggggctttgcggtcatcgat
ttcgaggaagtggacccccggctggggacgtgggaggacatcgaccagttaaagtcggat
ttccgtttaatgtttgacggagtttttaatcacgtctcctccaagagcaagtggttcgcc
gaatttcgtgacggagcgcccgactttcaggatttctttattgtcttttccaccagcgaa
gccatttccaaggagcatctcaagatcatcacacggcccaggcccacgcccatcctgagc
gagttttccacatacagcggatataaatgggtttggaccaccttttcgcccgaccagatc
gacctgaacttcaaaaatcccagggtgcttttaaaaaccatacagatccttttgtattat
atccgcagagggtcggacgtgctgcgcctggacgccgtgacctatttgtggcatgaactg
ggcacccattgcgtgcatttaaaggaaacccacgccattatccagctattcaggctgatt
atcgacgccgtggcgccggtggctgcgctgatcacggaaaccaacgttccccacgaccaa
aacatcacctatttcggcgacggaagcaacgaagcccacatggtgtataacttcgccctg
cctcccatggtgctccacgcctttcaaaacgaagacgctacagccttgaccaaatgggcc
tcctccctggatcaggtttccaaaaccgccacttatttcaattttctggactcccatgac
ggcgtgggcgtcactccggtcaaagaaatcctgtccgccaaggaaattgagcttatggcg
tggcgggtgatcgaacatggcggcttcatctcctataaagacgacggggacggcaacttg
agcccctatgaaatgaacatcacctggtggtcggccatcaaccgggaggatgcggacgaa
agcgatgattttcaggtgaagcgattctgcgcgtcgcgctccatcgccctggcgctcagg
ggggtgccgggaatttacttccatggcctgttgggctcaaaaaacgacgctgaagcggtt
attgcggaaaaacacacccgcagcatcaaccgcatggttctggattacagcagtctgaaa
gacggcttaaacaacccggaaagcaccacctacaaagtggtcaaccagtatggccgcatg
atcgccaaacgcgtgaaggaaaccgcgttccaccccaacgctccccaggatgtgctggat
ctgcacccggcgattttttgcgttaaacgcacctgccaggaggcggggcagccgctactg
gccttgacaaacgtgtccggcgaccaaattgttgtggagattccatgcaacacaacgggc
attcactgcaaccgctttgtggagattctatccggagacaggcggacctttgaaaccgat
aagggctttaatctgcaactaacaatggagccttatgacgtattttggctgaccccggcc
aaatag

DBGET integrated database retrieval system