KEGG   Desulfatibacillum alkenivorans: Dalk_0889Help
Entry
Dalk_0889         CDS       T00813                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dalk_0889
Enzymes [BR:dal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dalk_0889
Exosome [BR:dal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dalk_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1198128..1200149
Genome map
AA seq 673 aa AA seqDB search
MTKQGGPKEKAPGLVRSDPLLKPFLKDILRREDKIRAMHDRLVLKGKSLEEIASGHEFFG
LHFRDGEWIFREWAPNADAVYLTGPFTEWREKESCRLQRIDGNGAWEIRLPRRALHHEDV
YRLKIKWAWGEGDRIPAYARRVVQDWQTGIFNAQVWRPEKPYAWKHGDFIPEKPLLIYET
HVGMAQEEPKVGCFNEFREKILPRIKKAGYNTLQVMALPEHPYYGSFGYQVSSFFAPSSR
FGTPEELKELIDAAHGMGIAVVMDIIHSHAVSNEVEGLSCFDGTPYQYFHDGERGTHPAW
GSRCFDYSKPQVLHFLLSNCRYWQDEFRVDGFRFDGVTSMLYQDHGLGKAFTCYDDYYTE
NTDEDALVYLALANRLIHSLNPNAITVAEDVSGMPGLAMDESQGGYGFDYRFAMGVPDYW
IKLLKDQRDEDWHMGRLWHELTNKRTDEKTISYAESHDQALVGDQTLIFRMLEDDMFWYM
SLDRESLRVDRGMALHKMIRLITLATAGDGYLNFMGNEFGHPEWIDFPREGNDWSYHYAR
RQWSLMDAPNLRYGLLGRFDRDMIDMAKQSALPSGQAPIILRKDEDRKILAFLSHGLVFA
FNFHPTESYADCVIPAPAGAYSIILDTDRQAYGGHGRQDRDIRHFTQPGPKKGENYLSLY
LPSRTALVLGADK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacaaggaggccccaaggaaaaggcgcccggtctggttcgttcggacccgttg
ctcaagccttttctaaaggacattctccggcgcgaggacaaaatccgcgccatgcacgac
cggcttgtcctcaaggggaaaagcctggaggagatcgcctcgggccatgagtttttcggg
ctgcatttccgggacggcgagtggatctttcgggaatgggcgcccaacgccgacgcggtg
tacctgacagggccttttaccgaatggcgggagaaggaatcctgccgccttcaacgaatc
gacggaaacggcgcctgggaaattcgcctgccccggcgggccttgcatcacgaagacgtc
tatcgcctgaaaatcaagtgggcctggggcgagggagaccgcataccggcctacgcccgc
cgcgtggttcaggactggcagaccggcatattcaacgcccaggtgtggcggccggaaaag
ccctacgcctggaagcacggggatttcatcccggaaaagccgctattgatctacgaaacc
cacgtgggcatggcccaggaagagcccaaggtcggctgcttcaacgagtttcgggaaaag
atcctgccccggataaaaaaggcgggctacaacacccttcaggtcatggccctgcccgaa
cacccctattacgggtccttcgggtatcaggtctccagctttttcgccccctcctcccga
ttcggaacgcccgaggagcttaaggagttgatcgacgcagcccacggcatggggatcgcc
gtggtcatggacatcatccattcccacgcggtttccaacgaggtggaggggctttcgtgc
tttgacggcacgccctatcaatattttcacgacggggagcgcggaactcatccggcgtgg
gggtcgcgctgctttgactattccaagccccaggtgctgcactttctcctgtcaaactgc
cggtactggcaggacgagttccgcgtggacggattccggttcgacggcgtcaccagcatg
ctgtatcaagatcacggcctgggcaaggctttcacctgctacgacgattattataccgaa
aatacggacgaagacgccctggtctacctggccctggccaatcgcctgatacacagcctg
aatcccaacgccatcaccgtggccgaagacgtttccggcatgcccggcctggccatggac
gaaagccaaggcgggtacggctttgactatcgcttcgccatgggcgtgcccgactattgg
atcaagctcctgaaggaccagcgggatgaagactggcacatgggaagattgtggcacgag
ctcaccaacaagcggaccgacgaaaaaaccatcagctacgccgaatcccacgaccaggcc
ctggtgggcgaccaaaccctcattttccgtatgctggaagacgatatgttctggtacatg
tccctggatcgcgaaagcctccgggtggaccggggcatggccctgcataaaatgatccgg
ctgatcaccctggccacggccggggacgggtatctgaacttcatgggcaacgaattcggg
catccggaatggatcgactttccccgggaaggcaacgactggtcttaccactacgcccgc
cggcaatggagcctgatggacgcgcccaatctgcgctacgggttgttggggcggtttgat
cgggacatgatcgacatggcgaaacaaagcgccctgccctcgggccaggcgcccatcatc
ctgaggaaggatgaagacagaaaaatcctggctttcttaagccatggtttggttttcgcc
tttaacttccatccgacggaatcctatgcggactgcgttatcccggctccggccggggct
tattccatcatcctggatacggatcgccaggcctacggaggccacggcaggcaggatcgg
gacatccggcacttcacccagcccggccccaaaaaaggcgaaaactatttaagcctctat
ttgccttcgagaacggcgttggttttgggggcggataaatag

DBGET integrated database retrieval system