KEGG   Desulfatibacillum alkenivorans: Dalk_0896Help
Entry
Dalk_0896         CDS       T00813                                 

Definition
MCP methyltransferase/methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dal02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dal02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1206316..1209351)
Genome map
AA seq 1011 aa AA seqDB search
MTLQKQIISQESKREKSNTKVGSEDPSSDRGASFPIVAIGASAGGLGAFESFFSGMPADR
DPGMAFVLVQHLAPDHKSILVELIKRCTPMQVFEVSDGMEVQPNCAYIIPPNRNMAYSNG
SLHLLELVAPRGLRLPIDFFFRSLAQDLHERAIGIVLSGAGNDGAAGVRVIKAEGGMVMA
QSSESTTFNSMPHNAIATGLVDFVLAPADMPAQLIKYVTHAFGGQAISKMHQSEKKNENI
LEKVCVLLRAQTGHDFSNYKENTIIRRIERRMAIQQIERVKDYLRYLQQNQDEVEALFRD
LLIGVTNFFRDPEAFEALEALAVPRIFKNKPQGALIRVWVPGCSTGEEAYSIAMLLKECS
DALGTNAQVQIFATDIDSLAIDTARAGVYPASIAGDISPARLRRFFSLEPDGGAWRINKS
IRDMLVFSTQDLIRDPPFSKLDLISCRNLLIYMGGTLQKKLIPLFHYALKPDGFLFLGTS
ESVGEYADLFDCVDAKSKIYHRKEGLPRSPGPGIDRYFPPNANNETVLGMWRKVPVEPKL
PLREITERTLLQQYDPVGALVDKQGDILYLYGRSGLYLEPAPGEPGMNALKMAREGLKGK
LALALHQAASQRATVRHPGLRVKTNGEFTLTNLTIQPVPMQSLEGGSGPQLYLILLEKAQ
TRSLENTGAPSKALSMDPASAPLPGDADSITALRQELEAKDEYLQSTLEEMQTTNEELNS
SNEEMQSINEELQSTNEELETSKEELQSVNEELSTVNAELQKKVEELTRINNDMNNLLAG
TEIGTIFVDLKLCILRFTPTATQVINLIPTDVGRPLSHIVSNLEDYDSLIEDVNAVLENL
VPREVEARTLEGKWFLLRIRPYRTLENVIEGAVLTFTDITENRTMREALMESESANRLAA
VLRDVQDAITVQDMEGRILAWNPAAERIFGWSEAEALNMNICEMLPGNQYETTLLKIREC
AQATILQPQSIQRLSKSNRIVEILLTATPLIDKSGRVYAIVTIEREGHERT
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgactctccaaaaacaaatcatctcccaagaatcaaaaagagaaaaatccaacacaaag
gtgggttcggaggatccttccagcgatagaggcgcatctttccccatcgtcgctatcggc
gcctccgccggggggctgggagcctttgaatcatttttttccggaatgcccgcggacaga
gaccctggcatggcatttgttcttgtgcagcatttggccccggaccacaagagcattctt
gtggaattaattaaacgctgcacccccatgcaggtgtttgaggtttcggatgggatggag
gttcagccgaattgcgcctatataattcctcccaaccggaatatggcttatagtaatgga
tctctccatctgttggagcttgtggcgccgcgcggtttgcggctccccatcgactttttt
ttccgctcccttgcccaggatctgcacgagcgtgctattggaatagtgctttccggcgca
ggaaatgatggcgccgcgggtgttcgcgttatcaaggcggaagggggcatggtgatggct
cagagcagcgaatccaccacgttcaacagcatgccgcacaacgccatcgccaccggcttg
gtggattttgttttagcgcctgctgatatgcctgctcagctcattaaatatgttacacac
gcttttggaggccaggcaatttcgaaaatgcatcaatccgagaaaaaaaatgaaaatatc
cttgaaaaggtgtgtgttctattacgcgcccaaaccggccacgatttttccaattacaag
gaaaacaccatcatccgccgcattgagcggcggatggctatccagcaaattgaacgcgtc
aaggactaccttcgctatttacagcaaaatcaggatgaagtggaagccctgtttcgggat
ttgctaataggcgtcactaactttttcagggatcccgaggccttcgaggcccttgaagcc
ctggcagtgccgcgtatttttaaaaacaagcctcagggcgccttaatccgtgtctgggtc
ccaggctgttcaacaggcgaagaggcttactccattgccatgcttcttaaggagtgttcg
gatgcattggggaccaatgcgcaggtgcagatctttgctacggacattgacagccttgct
attgatacggcccgtgcaggcgtctatccggccagtattgcgggcgacatatccccggca
cgcctgaggcggtttttttccttggagccggatggaggcgcctggcgcatcaataagagc
attcgcgatatgctggtcttttccacacaggatctgataagggacccgccgttttccaag
ctcgacttaattagttgccggaaccttttgatctatatggggggaactctgcagaaaaaa
cttattccccttttccattatgcgctgaaacctgatgggtttcttttcctggggacttct
gaaagcgtgggcgagtacgccgacttgttcgactgtgtggacgccaaatccaagatttat
catcgaaaggaaggtttgccgagaagtcccgggccgggaattgaccggtattttccgcct
aatgcgaataatgaaactgttctgggaatgtggagaaaggtccctgtggaacccaaactg
ccgttgcgggagatcacggaaaggacgctgctgcagcagtatgatccggttggcgccctt
gtggacaagcaaggagatattctctacctttacggaagatcgggcctttacctggaaccg
gccccgggagagccgggaatgaatgccttgaaaatggctcgtgaaggtcttaagggaaaa
ctggccctggccttgcatcaagccgcttcgcaaagggcaaccgtgcgccatcccgggctg
cgagtgaaaacgaacggtgaatttacgcttaccaacctcaccatacagcctgtacccatg
cagtcattggaaggcggctctggccctcagctgtatttaattcttcttgaaaaagctcag
accaggagcttggagaataccggcgctccttccaaggcgctatccatggacccggcttcc
gcccccctccccggggacgccgattccattaccgccttgcgccaggaactggaggccaag
gacgaatatctgcaatccaccctggaggagatgcagaccaccaatgaggagcttaactcc
tccaatgaagaaatgcaatccatcaacgaggagttgcaatccaccaacgaggagttggag
acttccaaggaggagctccagtcggttaacgaggaattatccacggtcaatgcggagttg
caaaaaaaggttgaggaactgactcgcattaacaacgacatgaacaatctgctggcggga
accgaaatcggcaccattttcgtggatctcaagttgtgcattctgcgttttactcccaca
gccacccaggtgataaacctgattccaacggatgtgggccgcccactcagtcatattgta
tccaatctggaagactatgactccctgattgaggatgtgaatgccgtactggaaaacctg
gttcccagagaagtcgaagcccggacccttgaaggcaaatggttcctcctgcgcatccgg
ccctaccgcacgctggaaaacgtgattgaaggcgccgtgctcacctttacggatatcacg
gaaaaccgaaccatgcgggaggctttgatggagtccgagtccgcaaaccgcctggcggca
gtgcttcgggatgtgcaggacgcgattacggtacaggatatggaaggccgcatcctggcc
tggaatcccgcggccgaacgcattttcggctggagcgaagctgaagctctgaacatgaat
atttgcgagatgctgcccgggaatcagtacgagaccactctgttgaaaatccgggagtgc
gcccaagccactattctgcagccgcaaagcatccaacgcctctccaagagtaatcggatc
gtggagattctgctgaccgccactccgttgattgataaatccggaagggtttatgccatc
gtgaccatagaaagggaagggcatgaaaggacatag

DBGET integrated database retrieval system