KEGG   Desulfatibacillum alkenivorans: Dalk_0903Help
Entry
Dalk_0903         CDS       T00813                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dal  Desulfatibacillum alkenivorans
Brite
Enzymes [BR:dal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dalk_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ACL02608
JGI: Dalk0903
UniProt: B8FI41
Position
complement(1216736..1217395)
Genome map
AA seq 219 aa AA seqDB search
MKPLKNDPYAGRRKQMVRTQIQARGVSDPKVLEAMDTVPRHLFVSEALHDQAYQDFPLPI
GEGQTISQPYIVAEMTQALNLTKEDRVLEIGTGCGYQTAVLAQLAYKVYTIERIRSLFIG
ARRIFDELGFHNIVARCADGTLGWQDEAPFDAIIVTAGAPITPKALISQLAMGGRLIIPV
GDQSVQSLKKIVRDENGIHESDLGACRFVKLVGEQGWRD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacctttaaaaaacgatccatacgccgggcgccgcaaacaaatggtccgaacccag
attcaggcccgcggcgtcagcgatcccaaggtcctggaagccatggacaccgtgcccagg
cacctgtttgtgagcgaggctttgcatgatcaggcgtatcaggactttcccctgcccatc
ggcgaggggcagaccatttcccagccctatatcgtggcggaaatgacccaggccctgaac
ctgaccaaagaggacagggttttggaaatcggaaccggatgcgggtatcagacagccgtc
ctggcccaactcgcctacaaggtgtataccattgaacggattcgcagcctgttcatcggc
gcacgcaggattttcgacgaactgggctttcataatatcgtggcccgttgcgctgacgga
acgctgggctggcaggacgaagcgccttttgacgccattatcgtcaccgcaggggcgccc
ataacccccaaagcgcttatcagccaactggccatgggggggcggctgatcattccggtg
ggggatcaaagcgtacaatccttaaaaaaaatcgtgcgggatgaaaacggaattcacgaa
tccgaccttggcgcctgccgattcgttaaactggtgggggagcaggggtggagggattga

DBGET integrated database retrieval system