KEGG   Desulfatibacillum alkenivorans: Dalk_1022Help
Entry
Dalk_1022         CDS       T00813                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dalk_1022
   01230 Biosynthesis of amino acids
    Dalk_1022
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_1022
   00030 Pentose phosphate pathway
    Dalk_1022
   00051 Fructose and mannose metabolism
    Dalk_1022
   00052 Galactose metabolism
    Dalk_1022
  Energy metabolism
   00680 Methane metabolism
    Dalk_1022
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dalk_1022
Protein phosphatases and associated proteins [BR:dal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dalk_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1354260..1355360)
Genome map
AA seq 366 aa AA seqDB search
MSDRMRIAINTGGGDAPGLNAVIEAVVLSAYNKNWEVYGIKQGYHGLLDTEDIIRLDPNK
VRNISNLGGTILGTTNKGNPFEMPVENIAGEVEKRDLSDRVVQNFHRLGLDCLIAVGGDG
SLKIAHDFHKKGIPVIGVPKTIDNDLSGTVVTFGFDTAVSIATEAIDRLHSTAKSHDRVL
VVEVMGRNAGWIALNSGVSGGAKVILIPEIPFDMDLVCEKIMEGEVMGERYAIVVVAEGA
VPLGGRIVHKGSGEAGRQEVVLGGIGEVVAQSIAAKTGKDTRSLVLGHLQRGGSPTTFDR
LLALRFGAMAIRLVEEGKFGHMVALAPPNVSSVPLEDAIGTSKQVPMDSDTLRTAKDIGI
SFGAPE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagaatgcggatagccatcaacacgggcggcggagacgctccgggccttaac
gcggtcattgaggccgtggttttaagcgcctacaataaaaactgggaagtctacggcatc
aagcagggctatcacgggctgctggatacggaagacattattcgcctggatcccaacaag
gttcggaacatctccaacctggggggcaccatcctgggaaccaccaacaagggcaatccc
tttgaaatgccggtggaaaacattgccggcgaggtggaaaaacgggatctttccgatcgg
gtggtgcagaattttcaccgactgggcctggattgcctcatcgccgtggggggcgatggc
agcctgaaaatcgcccatgattttcacaaaaaaggcattccggtcattggcgtgcccaag
accatagacaacgacctctccggcacggtggtcacctttggctttgatacggccgtaagc
attgccaccgaagccatcgaccggctacactccacggccaaatcccacgaccgggtgctg
gtggtggaggtcatgggccgaaacgccggttggattgctttaaacagcggcgtgtccggc
ggcgccaaggtgattttgatcccggaaattccctttgacatggacctggtctgcgaaaaa
atcatggaaggggaggtcatgggggaacgctacgccatcgtggtggtggctgaaggcgcc
gtccccctgggaggccgtatcgttcacaagggctcgggagaagccggccgtcaggaagtg
gtgctgggcggcatcggcgaggtggtggcccagtccatcgccgccaaaaccggcaaggac
acccggtccctggttttagggcatctccagcggggcggttcgcccaccacattcgacagg
ctgctggctttgcgctttggcgccatggccatccggctggtggaagagggcaagttcggc
cacatggtggccctggcgcctcccaatgtgtcctccgtgcctttggaagacgccatcggc
accagcaagcaggtgcccatggattccgacaccctgcgcacggccaaggatatcggcatc
agcttcggcgcgccggaataa

DBGET integrated database retrieval system