KEGG   Desulfatibacillum alkenivorans: Dalk_1022Help
Entry
Dalk_1022         CDS       T00813                                 

Definition
(GenBank) 6-Phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00010  Glycolysis / Gluconeogenesis
dal00030  Pentose phosphate pathway
dal00051  Fructose and mannose metabolism
dal00052  Galactose metabolism
dal00680  Methane metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_1022
   00030 Pentose phosphate pathway
    Dalk_1022
   00051 Fructose and mannose metabolism
    Dalk_1022
   00052 Galactose metabolism
    Dalk_1022
  Energy metabolism
   00680 Methane metabolism
    Dalk_1022
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dalk_1022
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Dalk_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACL02725
JGI: Dalk1022
UniProt: B8FK50
Position
complement(1354260..1355360)
Genome map
AA seq 366 aa AA seqDB search
MSDRMRIAINTGGGDAPGLNAVIEAVVLSAYNKNWEVYGIKQGYHGLLDTEDIIRLDPNK
VRNISNLGGTILGTTNKGNPFEMPVENIAGEVEKRDLSDRVVQNFHRLGLDCLIAVGGDG
SLKIAHDFHKKGIPVIGVPKTIDNDLSGTVVTFGFDTAVSIATEAIDRLHSTAKSHDRVL
VVEVMGRNAGWIALNSGVSGGAKVILIPEIPFDMDLVCEKIMEGEVMGERYAIVVVAEGA
VPLGGRIVHKGSGEAGRQEVVLGGIGEVVAQSIAAKTGKDTRSLVLGHLQRGGSPTTFDR
LLALRFGAMAIRLVEEGKFGHMVALAPPNVSSVPLEDAIGTSKQVPMDSDTLRTAKDIGI
SFGAPE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagaatgcggatagccatcaacacgggcggcggagacgctccgggccttaac
gcggtcattgaggccgtggttttaagcgcctacaataaaaactgggaagtctacggcatc
aagcagggctatcacgggctgctggatacggaagacattattcgcctggatcccaacaag
gttcggaacatctccaacctggggggcaccatcctgggaaccaccaacaagggcaatccc
tttgaaatgccggtggaaaacattgccggcgaggtggaaaaacgggatctttccgatcgg
gtggtgcagaattttcaccgactgggcctggattgcctcatcgccgtggggggcgatggc
agcctgaaaatcgcccatgattttcacaaaaaaggcattccggtcattggcgtgcccaag
accatagacaacgacctctccggcacggtggtcacctttggctttgatacggccgtaagc
attgccaccgaagccatcgaccggctacactccacggccaaatcccacgaccgggtgctg
gtggtggaggtcatgggccgaaacgccggttggattgctttaaacagcggcgtgtccggc
ggcgccaaggtgattttgatcccggaaattccctttgacatggacctggtctgcgaaaaa
atcatggaaggggaggtcatgggggaacgctacgccatcgtggtggtggctgaaggcgcc
gtccccctgggaggccgtatcgttcacaagggctcgggagaagccggccgtcaggaagtg
gtgctgggcggcatcggcgaggtggtggcccagtccatcgccgccaaaaccggcaaggac
acccggtccctggttttagggcatctccagcggggcggttcgcccaccacattcgacagg
ctgctggctttgcgctttggcgccatggccatccggctggtggaagagggcaagttcggc
cacatggtggccctggcgcctcccaatgtgtcctccgtgcctttggaagacgccatcggc
accagcaagcaggtgcccatggattccgacaccctgcgcacggccaaggatatcggcatc
agcttcggcgcgccggaataa

DBGET integrated database retrieval system