KEGG   Desulfatibacillum alkenivorans: Dalk_1323Help
Entry
Dalk_1323         CDS       T00813                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Dalk_1323
Enzymes [BR:dal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Dalk_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1745645..1746949)
Genome map
AA seq 434 aa AA seqDB search
MERKNVYVGMSADLVHPGHLNIINRAAELGDVTVGLLTDRAIASYKRLPFMTYEQRKTVV
ENLKNVKNVVAQETLDYVPNLKEYKPDYVVHGDDWKEGVQSQVRQAVIDALSEWGGELVE
VPYTLGISSTQLHKVFKEIGTTPDIRRNKLRRLLNAKPLLRILEVHNGLTSLIVENISIE
NEQGRCEFDGMWSSSLTESTAKGKPDIEAVDVTARMNTLHDIMEVTTKPLIYDADTGGKI
EHFKFTVRTLERLGVSAAIIEDKVGLKKNSLFGTEVKQTQDTIDHFCEKIRAGKAAQVTE
EFMVIARIESLILEAGMTDAVDRARAYIQAGADGIMIHSRQKEPDEIFEFCKEYKTFYRK
VPLVVIPTSYNQVTENDLAEHGINIVIYANHLLRAAYPAMVKTAESILTHKRSKEVDFEL
FSIKNILELIPGTK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaaaaaacgtttacgtggggatgagcgctgacttggttcatccggggcatctc
aacattatcaatagggcggctgaactcggcgatgttaccgtcggtctgcttactgacaga
gcaattgccagttataaaagattgccgtttatgacctatgagcagagaaagactgttgtg
gaaaatttaaaaaatgtaaaaaatgtcgttgcacaggaaaccctggattacgttcctaat
ctaaaagaatacaagcctgactatgtcgtacacggggacgactggaaagaaggtgtacag
tcccaggtacgccaggccgttatcgatgcactgtcggaatggggaggggaacttgttgaa
gtaccctacactttaggtatatcttcaacccagttgcacaaggttttcaaggagatcggg
acgacgccggacattcgaagaaacaaactgcggcgcctgctaaacgctaaaccactgctt
cgtattcttgaggtacacaacggactgaccagccttattgttgagaatatcagcatagaa
aatgaacaaggccgatgtgagtttgacggaatgtggtccagtagcctgacagaatccact
gccaagggaaaaccggatattgaggcggtagatgtgacagcacgaatgaatactcttcac
gatattatggaggtgaccaccaagccactaatttatgatgcagataccggcggtaagatt
gagcattttaaatttacagtacgcacacttgagaggctgggggtttcagcagccatcata
gaggacaaggttggtttgaaaaagaactctttgttcggtaccgaggttaagcagacccag
gatacaatcgatcatttctgcgagaaaataagagctggcaaggctgcccaggtgacagag
gagtttatggtcatcgcaagaattgaaagcctgatacttgaagcaggtatgacagacgct
gtggacagagccagagcctatatccaggctggtgcggatgggattatgatacacagccga
caaaaagagccggatgaaatttttgaattctgcaaggaatacaagacgttctatcgcaaa
gttcctttggtggtgattcccacgagctataaccaagtcactgaaaatgatttggcagag
catggtatcaatattgtaatctatgccaatcacctcctaagggccgcttatcctgcaatg
gtgaaaacagcagaatcaatcctcactcacaagcgctcaaaggaagtcgattttgagctg
ttttcaattaaaaatatactcgagcttataccggggacaaaataa

DBGET integrated database retrieval system