KEGG   Desulfatibacillum alkenivorans: Dalk_1354Help
Entry
Dalk_1354         CDS       T00813                                 

Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dalk_1354
   01230 Biosynthesis of amino acids
    Dalk_1354
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_1354
   00051 Fructose and mannose metabolism
    Dalk_1354
   00562 Inositol phosphate metabolism
    Dalk_1354
Enzymes [BR:dal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dalk_1354
Exosome [BR:dal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dalk_1354
  Exosomal proteins of bladder cancer cells
   Dalk_1354
  Exosomal proteins of melanoma cells
   Dalk_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1780066..1780827)
Genome map
AA seq 253 aa AA seqDB search
MDARTPLIAGNWKMFKTPQEAARDAAALAELVKGVEGVDVMIAPTFACLVPVAQALEGSA
VALGAQNMHWETEGAYTGELSGPMLKAAGCSHVIIGHSERRQYFGETDETVNKKIKAALE
AGLKAVLCIGETEEERDQEKTLNVLDKQLKDGLKDIFPGSGEDALVVAYEPVWAIGTGKT
ATDDQAQEAHAFIRKVLAELLGKDLAKSTRILYGGSVKPANIAALMSKPDIDGGLVGGAS
LDPETFSQIVKFQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggacgccagaacgccgcttatcgccggaaactggaaaatgttcaagactccccaggag
gccgcccgcgacgcggccgccctggctgaactggtcaagggcgtagaaggcgtggacgtg
atgatcgcccccaccttcgcctgtctggttcccgtagcgcaagccctggagggaagcgcc
gtcgccctgggcgctcagaatatgcactgggagaccgaaggcgcctatacgggcgaactc
tccggccctatgctcaaggctgcggggtgctcccacgtgatcatcggccactcggaacgg
cgccagtatttcggcgagaccgacgaaaccgtgaataagaagatcaaggccgctctggag
gcgggtttgaaggctgttttgtgcatcggcgagacggaagaggaaagagatcaggaaaaa
acgctgaatgtgcttgacaaacagctcaaagacggtctaaaagacatttttcccggctcg
ggggaggacgccttggtggtcgcctatgagcctgtctgggccatcggcaccggcaaaacc
gcaaccgatgatcaagcccaggaagcccatgcatttatccgcaaggttttggctgaattg
ttaggaaaagatcttgccaaatccacacgcatattgtatggggggagcgtcaaaccggcc
aacatcgcagcgctgatgagcaagccggatattgacggaggactggtcggcggcgccagc
ttggatcctgagactttctcgcaaatagtcaagttccaataa

DBGET integrated database retrieval system