KEGG   Desulfatibacillum alkenivorans: Dalk_1433Help
Entry
Dalk_1433         CDS       T00813                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00260  Glycine, serine and threonine metabolism
dal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01130  Biosynthesis of antibiotics
dal01230  Biosynthesis of amino acids
Module
dal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dalk_1433
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dalk_1433
Enzymes [BR:dal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dalk_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ACL03133
JGI: Dalk1433
UniProt: B8FA37
Position
complement(1875950..1876747)
Genome map
AA seq 265 aa AA seqDB search
MSCIKNSFEALKAKNEKALVGFVTAGDPDFGKSVEIVKAMCEGGMDVLELGIPFSDPTAD
GPVIQRSSQRALSSGMSLPKVLEMVKIVRGFTKIPIVLFGYYNPIFSYGGKRFYEDALAA
GADGVLIVDLPPEESAELTSLWEGDDFDFIRLVAPTTGQDRMKQIAGEASGFIYLVSMTG
VTGSQGLDSSKVADVNAPLKAVTDLPVCVGFGISTPEHVKAVAAVSDGVVVGSAFERLIE
ENLENRGLHTMVQEYTESLKAATRG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaagaatagctttgaagcgttaaaggcaaagaacgaaaaggctttggtg
ggctttgtgacggccggggacccggatttcggcaagtccgtggagatcgtcaaagccatg
tgcgaaggcggcatggatgtgctggagcttggcatccccttttccgatcccacggcggac
gggcctgtgatccagcgctcctcccaacgcgccttgtcttcgggcatgagcctgcccaag
gttttggaaatggtgaagatcgtccggggtttcacgaaaatccccattgtcctgttcgga
tattacaacccgattttctcctacggcggaaagcgtttttacgaagacgccctggcagcg
ggcgcggacggcgtgctgattgtggatctgccgccggaggagtccgcggagctgacttct
ttatgggagggagacgatttcgacttcataaggctggtagcgcccaccacgggacaggac
cgcatgaagcagattgcgggcgaggcgtccgggttcatctatttggtttccatgacagga
gttacgggcagccagggtttggacagctccaaagtcgctgacgtcaacgcgcctttgaag
gctgtaacggacttgccggtttgcgtgggcttcggcatttccacgccggagcatgtgaag
gccgtggccgcagtgtccgacggcgtggttgtgggttcggcctttgaaagattgatcgag
gagaacctggaaaatcgcggcctgcataccatggttcaggaatacaccgaatcgctcaaa
gcggccaccaggggatag

DBGET integrated database retrieval system