KEGG   Desulfatibacillum alkenivorans: Dalk_1433Help
Entry
Dalk_1433         CDS       T00813                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dalk_1433
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dalk_1433
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dalk_1433
Enzymes [BR:dal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dalk_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1875950..1876747)
Genome map
AA seq 265 aa AA seqDB search
MSCIKNSFEALKAKNEKALVGFVTAGDPDFGKSVEIVKAMCEGGMDVLELGIPFSDPTAD
GPVIQRSSQRALSSGMSLPKVLEMVKIVRGFTKIPIVLFGYYNPIFSYGGKRFYEDALAA
GADGVLIVDLPPEESAELTSLWEGDDFDFIRLVAPTTGQDRMKQIAGEASGFIYLVSMTG
VTGSQGLDSSKVADVNAPLKAVTDLPVCVGFGISTPEHVKAVAAVSDGVVVGSAFERLIE
ENLENRGLHTMVQEYTESLKAATRG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaagaatagctttgaagcgttaaaggcaaagaacgaaaaggctttggtg
ggctttgtgacggccggggacccggatttcggcaagtccgtggagatcgtcaaagccatg
tgcgaaggcggcatggatgtgctggagcttggcatccccttttccgatcccacggcggac
gggcctgtgatccagcgctcctcccaacgcgccttgtcttcgggcatgagcctgcccaag
gttttggaaatggtgaagatcgtccggggtttcacgaaaatccccattgtcctgttcgga
tattacaacccgattttctcctacggcggaaagcgtttttacgaagacgccctggcagcg
ggcgcggacggcgtgctgattgtggatctgccgccggaggagtccgcggagctgacttct
ttatgggagggagacgatttcgacttcataaggctggtagcgcccaccacgggacaggac
cgcatgaagcagattgcgggcgaggcgtccgggttcatctatttggtttccatgacagga
gttacgggcagccagggtttggacagctccaaagtcgctgacgtcaacgcgcctttgaag
gctgtaacggacttgccggtttgcgtgggcttcggcatttccacgccggagcatgtgaag
gccgtggccgcagtgtccgacggcgtggttgtgggttcggcctttgaaagattgatcgag
gagaacctggaaaatcgcggcctgcataccatggttcaggaatacaccgaatcgctcaaa
gcggccaccaggggatag

DBGET integrated database retrieval system