KEGG   Desulfatibacillum alkenivorans: Dalk_1620Help
Entry
Dalk_1620         CDS       T00813                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dalk_1620
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dalk_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2125268..2126902
Genome map
AA seq 544 aa AA seqDB search
MTGPKICVVGACNIDLISYVERLPVLGETLHGKKFSMGFGGKGANQAVMAAKLGGEVAMV
GKLGRDVFGENTLANFKKLGVNVSHVHFTEEAFSGVAPIAVDDNGANSIIIVTGASDLLS
AEEIRAAENAIAKSKVLVCQLEIPMEQNLEALRIARKNNVPTIFNPAPARPGLPDELYQL
SDIFCPNESETEILTGMPVETMEQAEQAAKALLERGPKTVILTLGERGCLLVDANGARHI
PTRKVEAIDTTGAGDCFVGSLAFFLAAGKSLEDAINRANKIAAVSVCGQGTQSSFPGASE
LDPEILSDIQPAESQAPAMSAKDLAQYIDHTLLKPEAPLSAFDKICEEAILHQFRSVCVN
SCKISYIAKKLKGTGVDACAVIGFPLGAMSTAAKAFEAKQAVMDGAAELDMVINVGALKS
GDFDAVFDDIKAVRDAAPLPIILKVIIETCLLTDEEKARACRIAKAADADFVKTSTGFST
GGATLEDIALMRDTVGPYMGVKASGGIKDAKTAIAMIEAGATRIGAGAGVEIVSGLQSDA
DGSY
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaccgaaaatatgcgttgtgggagcatgcaatattgacctgatcagctacgtg
gaaaggcttcccgtcctgggggagaccctgcacggcaagaagttctccatgggctttggg
ggcaaaggcgccaatcaggctgtcatggccgccaagctgggcggcgaggtcgccatggtg
ggcaagctgggccgggacgttttcggcgagaacaccctggccaacttcaagaagctggga
gtcaacgtgagtcacgtccattttacggaagaggctttttccggcgtggcgcccattgcc
gtggacgacaacggcgccaattccatcatcatcgtcacgggcgccagcgatctgctttcc
gccgaggaaatccgggccgccgaaaacgccattgcaaaatccaaggtgctcgtctgccaa
ttggaaattcccatggaacagaacctggaagccctgcgcatcgcccggaaaaacaacgtg
ccgaccatattcaacccggccccggccaggcccggcctgccggatgagttgtatcagctt
agcgacatcttctgccccaatgaaagcgagacggagatcctcaccggcatgcccgtggaa
accatggagcaggcggagcaagccgcaaaggccttgttggagcgcggccccaagacggtg
atcctcactctgggcgagcgcgggtgcctgctggtggacgcaaacggcgccaggcatatt
cccacaaggaaagtcgaggccatcgacaccaccggcgccggagactgttttgtaggcagc
ctggcctttttcctggctgcgggaaaatccctggaggacgccatcaatcgagccaacaaa
atcgcggccgtcagcgtgtgcggccagggcacccaatccagctttcccggcgcaagcgaa
ctcgacccggaaattttatcggatattcaaccggccgaatcccaggcgccggccatgagc
gccaaggacctggcccagtacatcgaccacaccttgttgaagcccgaagcgccgctttcg
gctttcgacaaaatttgtgaagaggcgatcctgcatcaattccggtccgtgtgcgtaaac
tcctgcaagatttcctatattgcgaaaaaactgaagggaaccggcgtggatgcatgcgcg
gtgattggcttccccctgggcgccatgagtacggcggccaaggcttttgaggccaaacag
gcggtcatggacggcgcggccgaactggacatggtcatcaacgtgggcgccttgaaatcc
ggggattttgacgccgtattcgacgacatcaaagcggtgcgggacgccgcgcccttgccg
atcatcctcaaggtgatcatcgaaacctgcctgctgacggacgaggaaaaggcccgggcc
tgccggatcgccaaagccgcggacgcggacttcgtcaagaccagcacgggcttttccaca
ggcggcgcgaccctggaggacatcgccctcatgcgggataccgttgggccgtatatgggc
gtgaaagccagcggcggcatcaaggacgccaagacggccatagccatgattgaggctggc
gcaacccgcattggcgcaggcgcgggcgtggaaatcgtcagcggcttgcaaagcgacgca
gacggaagctattag

DBGET integrated database retrieval system