KEGG   Desulfatibacillum alkenivorans: Dalk_1932Help
Entry
Dalk_1932         CDS       T00813                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00230  Purine metabolism
dal01100  Metabolic pathways
Module
dal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dalk_1932
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dalk_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase AAA_23 MMR_HSR1 Thymidylate_kin AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACL03629
JGI: Dalk1932
UniProt: B8FEV2
Position
2513045..2513647
Genome map
AA seq 200 aa AA seqDB search
MSPNSRGKLFIMSAPSGAGKSTLREALCARQPNLAYSVSHTTRPPRQGEKNGVDYHFTSK
EDFLQGIEDARWAEWAEVHGNYYGTSARFIARCLDRGCFVLLDIDVQGTEKILKRFPEAV
TLFIMPPSMEVLEQRLSSRGTDAPEVIAQRLENAKGEMNKRSLYKHILVNDDLETAISEL
EGVMLQYGAPPPCPEAERRS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgaatagccggggcaaactatttatcatgtccgccccctccggagcgggcaag
tccaccctcagggaggccctgtgcgcaagacagcccaacctggcctattcggtgtcccac
accacccgccctccccggcagggggaaaaaaacggcgtggattaccatttcacgtccaag
gaggatttcctccaaggcattgaggacgcgcggtgggccgaatgggccgaagtccatggc
aattattacggcaccagcgcccggtttatcgcccgctgcctggaccggggatgcttcgtg
ctcctggacatcgacgtccagggcacggaaaaaatcctcaaacgctttcccgaggccgtc
accctgttcatcatgccgccttccatggaggttttggagcaacggctttcaagccgggga
accgacgcaccggaagtgatcgcccaacgcctggaaaacgccaagggcgaaatgaacaaa
aggagcctgtataaacatatattggtgaacgacgacctggagacggccatcagcgaactg
gaaggcgtgatgctgcaatacggagcgcctcccccttgcccggaggcggagcggcgctca
tga

DBGET integrated database retrieval system