KEGG   Desulfatibacillum alkenivorans: Dalk_1932Help
Entry
Dalk_1932         CDS       T00813                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dal00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2513045..2513647
Genome map
AA seq 200 aa AA seqDB search
MSPNSRGKLFIMSAPSGAGKSTLREALCARQPNLAYSVSHTTRPPRQGEKNGVDYHFTSK
EDFLQGIEDARWAEWAEVHGNYYGTSARFIARCLDRGCFVLLDIDVQGTEKILKRFPEAV
TLFIMPPSMEVLEQRLSSRGTDAPEVIAQRLENAKGEMNKRSLYKHILVNDDLETAISEL
EGVMLQYGAPPPCPEAERRS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgaatagccggggcaaactatttatcatgtccgccccctccggagcgggcaag
tccaccctcagggaggccctgtgcgcaagacagcccaacctggcctattcggtgtcccac
accacccgccctccccggcagggggaaaaaaacggcgtggattaccatttcacgtccaag
gaggatttcctccaaggcattgaggacgcgcggtgggccgaatgggccgaagtccatggc
aattattacggcaccagcgcccggtttatcgcccgctgcctggaccggggatgcttcgtg
ctcctggacatcgacgtccagggcacggaaaaaatcctcaaacgctttcccgaggccgtc
accctgttcatcatgccgccttccatggaggttttggagcaacggctttcaagccgggga
accgacgcaccggaagtgatcgcccaacgcctggaaaacgccaagggcgaaatgaacaaa
aggagcctgtataaacatatattggtgaacgacgacctggagacggccatcagcgaactg
gaaggcgtgatgctgcaatacggagcgcctcccccttgcccggaggcggagcggcgctca
tga

DBGET integrated database retrieval system