KEGG   Desulfatibacillum alkenivorans: Dalk_2000Help
Entry
Dalk_2000         CDS       T00813                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dalk_2000 (recR)
DNA repair and recombination proteins [BR:dal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dalk_2000 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2592642..2593241
Genome map
AA seq 199 aa AA seqDB search
MSFYPPSLVNLIKQLSKLPGIGEKTAERLALHILRGSVKDAQALAESISEAKETVRLCSV
CYGLADSDPCHICRDATRDQDVVCVVEQGTDMVALEKSGAFKGRYHVLQGCLSPMNGVGP
DNLRIRELVERLKKEKIKEVVVATGTSVEGESTANYLRQVLEGSGVKITRIASGVPIGGD
LKYTDALTLKRALDSRHCL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtccttttaccctcccagcctggtcaatctgatcaaacagctttccaagctgcctgga
atcggagagaaaaccgccgaacgcctggccctccatattttaagaggatcggtcaaggac
gcccaggctttggctgagtccatatccgaagccaaggaaacggtccggctgtgctcggtc
tgctatggcctggccgactcggatccgtgccacatctgccgggacgcaacccgggatcag
gacgtggtctgcgtggtggagcaaggcacggatatggtggccctggaaaaatccggggcg
ttcaaggggcggtatcacgtgttgcaggggtgcttgtcgcccatgaacggcgtggggccg
gacaacctgcgcatccgcgagcttgtggagagattgaaaaaggaaaaaatcaaggaagtg
gttgtggccacaggcaccagcgtggagggggaatccaccgccaattatttgcgccaggtc
ctcgaggggtcgggcgtaaaaatcactcgcatagcctcgggcgttcccatcgggggcgac
ctgaaatacacggacgctctgacgcttaaaagggccttggactcccggcactgcctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system